Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human UHRF1(400-660) tagged Recombinant Protein |
---|---|
Uniprot ID | Q96T88 |
Uniprot link | http://www.uniprot.org/uniprot/Q96T88 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MAHNHRHKHKLMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDD VDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAP AEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREE EEQQEGGFASPRTGKGKWKRKSAGGGPSRAG |
Molecular weight | 30,19 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | 100mM Na2HPO4, TrisHCl 10mM, Urea 8M in denaturing conditions. PBS if renaturation. |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Protein Accession | AAF28469.1 |
Spec:Entrez GeneID | 29128 |
Spec:NCBI Gene Aliases | hUHRF1, ICBP90, RNF106, Np95, huNp95, hNP95 |
Spec:SwissProtID | Q96T88 |
NCBI Reference | AAF28469.1 |
Aliases /Synonyms | ICBP[400-660], transcription factor ICBP90 |
Reference | PX-P2053 |
Note | For research use only |
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.