Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human PDGFB Recombinant Protein
| size | 100ug, 200ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human PDGFB Recombinant Protein |
|---|---|
| Uniprot ID | P01127 |
| Uniprot link | http://www.uniprot.org/uniprot/ P01127 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MEEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGALEHHHHHH |
| Molecular weight | 26.26 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 95% |
| Buffer | PBS,pH 7.5 urea +8M |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| NCBI Reference | P01127 |
| Aliases /Synonyms | PDGF-B, PDGF2, SIS, SSV, C-sis, Simian Sarcoma Viral(v-sis)Oncogene Homolog, Platelet Derived Growth Factor proteins Beta Polypeptide, Proto-oncogene c-Sis, Becaplermin, Platelet Derived Growth Factor proteins Subunit B,PDGFB |
| Reference | PX-P3029 |
| Note | For research use only |
Related products
Biosimilar
Olaratumab Biosimilar – Anti-PDGF-R alpha mAb – Research Grade
PX-TA1025 200€
Biosimilar
Tovetumab Biosimilar – Anti-PDGFRA , PDGFR2, CD140a mAb – Research Grade
PX-TA1328 200€
Biosimilar
Rinucumab Biosimilar – Anti-PDGFRB, PDGFR-1, CD140b mAb – Research Grade
PX-TA1400 200€
Receptor
Platelet Derived Growth Factor proteins Receptor Alpha
PX-P5106 420€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.