Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Human PAFAH-LpPLA2-PLA2G7 recombinant protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Mammalian cells

Applications

Elisa, WB

Product nameHuman PAFAH-LpPLA2-PLA2G7 recombinant protein
Uniprot IDQ13093 
Uniprot linkhttp://www.uniprot.org/uniprot/Q13093 
Origin speciesHomo sapiens (Human)
Expression systemEukaryotic expression
SequenceMVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTF LRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLY SAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSE YFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKGDIDSNAAIDLSNKASLAFLQKHLGLHK DFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYNGSHHHHHH
Molecular weight50.94kDa
Protein delivered with Tag?Yes
Purity estimated50%
BufferPBS, pH 7.5
FormLyophilized
Delivery conditionDry Ice
Delivery lead time in business days5-7
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesMammalian cells
Fragment TypeFull-length
Aliases /SynonymsPLA2G7, PAF-AH, PAFAH, Lp-PLA2, LDL-PLA2, Platelet Activating Factor Acetylhydrolase,Plasma, Phospholipase A2,Group VII, LDL-associated phospholipase A2
ReferencePX-P4061
NoteFor research use only

Description of Human PAFAH-LpPLA2-PLA2G7 recombinant protein

General Information about Human PAFAH/ LpPLA2/PLA2G7 recombinant protein

Lipoprotein-related phospholipase A2 (Lp-PLA2), also known as platelet activating factor acetyl hydrolase (PAF-AH), is a phospholipase A2 enzyme, which is encoded by the PLA2G7 gene in humans. Lp-PLA2 is a 45 kD protein of 441 amino acids. It is one of several PAF acetyl hydrolase enzymes. Lp-PLA2 is carried mainly with low-density lipoprotein (LDL) in the blood. Less than 20% are related to HDL. Several tests have shown that HDL-related Lp-PLA2 can significantly promote the anti-cancer effects of HDL. It is an enzyme produced by inflammatory cells that can hydrolyze oxidized phospholipids in LDL. Lp-PLA2 is a platelet activation factor (PAF) acetyl hydrolase, a secreted enzyme that can catalyze the degradation of PAF in inactive products by hydrolyzing the acetyl group at the sn-2 position, producing biologically inert products LYSO-PAF and acetate. Lp-PLA2 is involved in the development of atherosclerosis, and this discovery has aroused interest as a potential therapeutic target. In human atherosclerotic lesions, two main sources of Lp-PLA2 can be identified, including the source of LDL-binding intolerance (through the circulation) and the source of de novo synthesis of inflammatory plaque cells (Macrophages, T cells, mast cells). It is used as a marker of heart disease.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human PAFAH-LpPLA2-PLA2G7 recombinant protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products