Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human HMGB1 extracellular recombinant protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human HMGB1 extracellular recombinant protein |
|---|---|
| Uniprot ID | P09429 |
| Uniprot link | http://www.uniprot.org/uniprot/P09429 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MGSHHHHHHSGLEVLFQGPMGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
| Molecular weight | 26.97kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 85% |
| Delivery condition | Dry Ice |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Full-length |
| Spec:Entrez GeneID | 3146 |
| Aliases /Synonyms | Amphoterin, Chromosomal protein, nonhistone, HMG1, DKFZp686A04236, High mobility group 1, High mobility group box 1, High mobility group protein 1, High mobility group protein B1, high-mobility group (nonhistone chromosomal) protein 1, HMG-1, HMG1, HMG3, HMGB 1, HMGB1, HMGB1_HUMAN, NONHISTONE CHROMOSOMAL PROTEIN HMG1, SBP 1, Sulfoglucuronyl carbohydrate binding protein |
| Reference | PX-P4002 |
| Note | For research use only |
Related products
Biosimilar
Abatacept Biosimilar – Anti-CTLA-4 extracellular domain linked to IgG1 Fc mAb – Research Grade
PX-TA1020 200€
Biosimilar
Glembatumumab Biosimilar – Anti-GPNMB extracellular domain mAb – Research Grade
PX-TA1238 200€
Biosimilar
Vesencumab Biosimilar – Anti-Neuropilin-1, NRP1, VEGF165R extracellular domain mAb – Research Grade
PX-TA1266 200€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.