Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human Efa_120 Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human Efa_120 Recombinant Protein |
|---|---|
| Uniprot ID | P78417 |
| Uniprot link | http://www.uniprot.org/uniprot/P78417 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLPRVNSGLRCATMSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKN KPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKED YAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTV |
| Molecular weight | 26,79 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 95% |
| Buffer | PBS, imidazole 300mM |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | CAD97673.1 |
| Spec:Entrez GeneID | 9446 |
| Spec:NCBI Gene Aliases | SPG-R, GSTO 1-1, GSTTLp28, P28, HEL-S-21 |
| Spec:SwissProtID | P78417 |
| NCBI Reference | CAD97673.1 |
| Aliases /Synonyms | Efa_120, hypothetical protein, Glutathione S-transferase omega-1, GSTO1, GSTO-1, Glutathione S-transferase omega 1-1, GSTO 1-1, Glutathione-dependent dehydroascorbate reductase, Monomethylarsonic acid reductase, MMA(V) reductase, S-(Phenacyl)glutathione reductase, SPG-R |
| Reference | PX-P1085 |
| Note | For research use only |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.