Brand: ProteoGenix

Human COL17A1 recombinant protein

PX-P6518-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Human
Uniprot ID:: Q9UMD9
Molecular weight:: 37.72 kDa

Original price was: €245.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points

Glu490–Arg566 Fc

Size Size

50ug Original price was: €245.00.Current price is: €193.00.
100ug Original price was: €303.00.Current price is: €275.00.
1MG Original price was: €998.00.Current price is: €798.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Human COL17A1 recombinant protein

Product name	PX-P6518-100
Uniprot ID	Q9UMD9
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	EEVRKLKARVDELERIRRSILPYGDSMDRIEKDRLQGMAPAAGADLDKIGLHSDSQEELWMFVRKKLMMEQENGNLR
Molecular weight	37.72 kDa
Protein delivered with Tag?	C-Terminal Fc Tag
Buffer	PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Glu490-Arg566
Aliases /Synonyms	COL17A1, 180 kDa bullous pemphigoid antigen 2, LAD-1, Linear IgA bullous disease antigen of 97 kDa, 120 kDa linear IgA dermatosis antigen, 97-LAD, Collagen alpha-1(XVII) chain, Bullous pemphigoid antigen 2, 97 kDa linear IgA bullous dermatosis antigen, LABD97, 97 kDa LAD antigen, BPAG2, BP180Linear IgA disease antigen 1,
Reference	PX-P6518
Molecular Constructor	Glu490–Arg566 Fc

Product name	PX-P6518-1MG
Uniprot ID	Q9UMD9
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	EEVRKLKARVDELERIRRSILPYGDSMDRIEKDRLQGMAPAAGADLDKIGLHSDSQEELWMFVRKKLMMEQENGNLR
Molecular weight	37.72 kDa
Protein delivered with Tag?	C-Terminal Fc Tag
Buffer	PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Glu490-Arg566
Aliases /Synonyms	COL17A1, 180 kDa bullous pemphigoid antigen 2, LAD-1, Linear IgA bullous disease antigen of 97 kDa, 120 kDa linear IgA dermatosis antigen, 97-LAD, Collagen alpha-1(XVII) chain, Bullous pemphigoid antigen 2, 97 kDa linear IgA bullous dermatosis antigen, LABD97, 97 kDa LAD antigen, BPAG2, BP180Linear IgA disease antigen 1,
Reference	PX-P6518
Molecular Constructor	Glu490–Arg566 Fc

Product name	PX-P6518-50
Uniprot ID	Q9UMD9
Origin species	Human
Expression system	Eukaryotic expression
Raw Antigen Sequence	EEVRKLKARVDELERIRRSILPYGDSMDRIEKDRLQGMAPAAGADLDKIGLHSDSQEELWMFVRKKLMMEQENGNLR
Molecular weight	37.72 kDa
Protein delivered with Tag?	C-Terminal Fc Tag
Buffer	PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Glu490-Arg566
Aliases /Synonyms	COL17A1, 180 kDa bullous pemphigoid antigen 2, LAD-1, Linear IgA bullous disease antigen of 97 kDa, 120 kDa linear IgA dermatosis antigen, 97-LAD, Collagen alpha-1(XVII) chain, Bullous pemphigoid antigen 2, 97 kDa linear IgA bullous dermatosis antigen, LABD97, 97 kDa LAD antigen, BPAG2, BP180Linear IgA disease antigen 1,
Reference	PX-P6518
Molecular Constructor	Glu490–Arg566 Fc