Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human ChromograninA Partial (19-260) Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human ChromograninA Partial (19-260) Recombinant Protein |
|---|---|
| Uniprot ID | P10645 |
| Uniprot link | http://www.uniprot.org/uniprot/P10645 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MGSSHHHHHHSSGLPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSL |
| Molecular weight | 50.26 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | #N/A |
| Buffer | Tris-HC 50mMl, pH 7.5, NaCl 150mM |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Spec:NCBI Gene Aliases | CGA |
| Spec:SwissProtID | P10645 |
| Aliases /Synonyms | ChromograninA Partial [19-260], chromogranin A (parathyroid secretory protein 1), Chromogranin-A, CgA, Pituitary secretory protein I, SP-I |
| Reference | PX-P2103 |
| Note | For research use only |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.