Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human ChromograninA Partial (19-260) Recombinant Protein |
---|---|
Uniprot ID | P10645 |
Uniprot link | http://www.uniprot.org/uniprot/P10645 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MGSSHHHHHHSSGLPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSL |
Molecular weight | 50.26 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | #N/A |
Buffer | Tris-HC 50mMl, pH 7.5, NaCl 150mM |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Spec:NCBI Gene Aliases | CGA |
Spec:SwissProtID | P10645 |
Aliases /Synonyms | ChromograninA Partial [19-260], chromogranin A (parathyroid secretory protein 1), Chromogranin-A, CgA, Pituitary secretory protein I, SP-I |
Reference | PX-P2103 |
Note | For research use only |
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.