Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Human CD86, B7-2 recombinant protein |
---|---|
Uniprot ID | P42081 |
Uniprot link | http://www.uniprot.org/uniprot/P42081 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPGSHHHHHH |
Molecular weight | 28.92kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | PBS, pH 7.5 |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Partial |
Aliases /Synonyms | CD86, B7-2, B70, FUN-1, CD28LG2, CD28 Antigen Ligand 2,B7-2 Antigen, CTLA-4 counter-receptor B7.2 |
Reference | PX-P4041 |
Note | For research use only |
Cluster of Differentiation 86 (also known as CD86 and B7-2) is a protein expressed in antigen presenting cells, which provides co-stimulatory signals necessary for T cell activation and survival. It is a ligand for two different proteins on the cell surface. T: CD28 (for self-regulation and cell-cell binding) and CTLA-4 (to attenuate cell regulation and separation). CD86 and CD80 act together on primary T cells. This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. The protein is expressed because it contains antigens, and is a ligand for two proteins on the surface of T cells, the CD28 antigen and the cytotoxic T lymph.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.