Brand: ProteoGenix

Human CD86, B7-2 recombinant protein

PX-P4041-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: P42081
Molecular weight:: 28.92kDa

€210.00

50ug + 210 loyalty points

Partial Yes

size size

50ug €210.00
100ug €420.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Human CD86, B7-2 recombinant protein

Product name	Human CD86, B7-2 recombinant protein
Uniprot ID	P42081
Uniprot link	http://www.uniprot.org/uniprot/P42081
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPGSHHHHHH
Molecular weight	28.92kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	CD86, B7-2, B70, FUN-1, CD28LG2, CD28 Antigen Ligand 2,B7-2 Antigen, CTLA-4 counter-receptor B7.2
Reference	PX-P4041
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human CD86, B7-2 recombinant protein
Uniprot ID	P42081
Uniprot link	http://www.uniprot.org/uniprot/P42081
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPGSHHHHHH
Molecular weight	28.92kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	CD86, B7-2, B70, FUN-1, CD28LG2, CD28 Antigen Ligand 2,B7-2 Antigen, CTLA-4 counter-receptor B7.2
Reference	PX-P4041
Note	For research use only
Molecular Constructor	Partial Yes

General Information about Human CD86/B7-2 recombinant protein

Cluster of Differentiation 86 (also known as CD86 and B7-2) is a protein expressed in antigen presenting cells, which provides co-stimulatory signals necessary for T cell activation and survival. It is a ligand for two different proteins on the cell surface. T: CD28 (for self-regulation and cell-cell binding) and CTLA-4 (to attenuate cell regulation and separation). CD86 and CD80 act together on primary T cells. This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. The protein is expressed because it contains antigens, and is a ligand for two proteins on the surface of T cells, the CD28 antigen and the cytotoxic T lymph.

There are no reviews yet.

Be the first to review “Human CD86, B7-2 recombinant protein”

Human CD86, B7-2 recombinant protein

Human CD86, B7-2 recombinant protein

General Information about Human CD86/B7-2 recombinant protein

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human CD86, B7-2 recombinant protein

Specifications Human CD86, B7-2 recombinant protein

Description

General Information about Human CD86/B7-2 recombinant protein

Documents

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human CD86, B7-2 recombinant protein