Name: Human CD36 (AA 104-294) Recombinant Protein
SKU: PX-P1061-10
Availability: InStock

Wide range of unique reagents
Free shipping in EU on Orders > €500
Fast worldwide delivery

size	100ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Escherichia coli (E. coli)
Applications	Elisa, WB

Cancer Stem Cell

Product name	Human CD36 (AA 104-294) Recombinant Protein
Uniprot ID	P16671
Uniprot link	http://www.uniprot.org/uniprot/P16671
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MAHNHRHKHKLTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQV RTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAA SFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRF
Molecular weight	22,73 kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	PBS, imidazole 300mM, Urea 8M, pH7.4
Form	liquid
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Partial
Protein Accession	AAA16068.1
Spec:Entrez GeneID	948
Spec:NCBI Gene Aliases	CHDS7, GPIV, PASIV, FAT, SCARB3, GP3B, BDPLT10, GP4
Spec:SwissProtID	P16671
NCBI Reference	AAA16068.1
Aliases /Synonyms	CD36 (AA 104-294), antigen CD36, Platelet glycoprotein 4, Fatty acid translocase, FAT, Glycoprotein IIIb, GPIIIB, Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV, GPIV, Thrombospondin receptor, CD_antigen: CD36, GP3B, GP4
Reference	PX-P1061
Note	For research use only

Datasheet Download

MSDS Download

Publication

1: Šerý O, Janoutová J, Ewerlingová L, Hálová A, Lochman J, Janout V, Khan NA,_x000D_ Balcar VJ. CD36 gene polymorphism is associated with Alzheimer's disease._x000D_ Biochimie. 2017 Apr;135:46-53. doi: 10.1016/j.biochi.2017.01.009. Epub 2017 Jan_x000D_ 20. PubMed PMID: 28111291.
2: Sini S, Deepa D, Harikrishnan S, Jayakumari N. High-density lipoprotein from_x000D_ subjects with coronary artery disease promotes macrophage foam cell formation:_x000D_ role of scavenger receptor CD36 and ERK/MAPK signaling. Mol Cell Biochem. 2017_x000D_ Mar;427(1-2):23-34. doi: 10.1007/s11010-016-2895-7. Epub 2016 Dec 19. PubMed_x000D_ PMID: 27995417.
3: Pascual G, Avgustinova A, Mejetta S, Martín M, Castellanos A, Attolini CS,_x000D_ Berenguer A, Prats N, Toll A, Hueto JA, Bescós C, Di Croce L, Benitah SA._x000D_ Targeting metastasis-initiating cells through the fatty acid receptor CD36._x000D_ Nature. 2017 Jan 5;541(7635):41-45. doi: 10.1038/nature20791. Epub 2016 Dec 7._x000D_ PubMed PMID: 27974793.
4: Kalai M, Dridi M, Chaouch L, Moumni I, Ouragini H, Darragi I, Boudrigua I,_x000D_ Chaouachi D, Mellouli F, Bejaoui M, Abbes S. The role of rs1984112_G at CD36 gene_x000D_ in increasing reticulocyte level among sickle cell disease patients. Hematology. _x000D_ 2017 Apr;22(3):178-182. doi: 10.1080/10245332.2016.1253253. Epub 2016 Nov 20._x000D_ PubMed PMID: 27869039.
5: Jayewardene AF, Mavros Y, Gwinn T, Hancock DP, Rooney KB. Associations between_x000D_ CD36 gene polymorphisms and metabolic response to a short-term endurance-training_x000D_ program in a young-adult population. Appl Physiol Nutr Metab. 2016_x000D_ Feb;41(2):157-67. doi: 10.1139/apnm-2015-0430. Epub 2015 Oct 22. PubMed PMID:_x000D_ 26830498.
6: Daoudi H, Plesník J, Sayed A, Šerý O, Rouabah A, Rouabah L, Khan NA. Oral Fat _x000D_ Sensing and CD36 Gene Polymorphism in Algerian Lean and Obese Teenagers._x000D_ Nutrients. 2015 Nov 4;7(11):9096-104. doi: 10.3390/nu7115455. PubMed PMID:_x000D_ 26556365; PubMed Central PMCID: PMC4663583.
7: Lo SC, Lin KH, Hsieh HH, Lin DT, Hu CY. Genetic variations of CD36 and low_x000D_ platelet CD36 expression - a risk factor for lipemic plasma donation in Taiwanese_x000D_ apheresis donors. Vox Sang. 2016 Apr;110(3):236-43. doi: 10.1111/vox.12356. Epub _x000D_ 2015 Nov 3. PubMed PMID: 26528880.
8: Hou Y, Wu M, Wei J, Ren Y, Du C, Wu H, Li Y, Shi Y. CD36 is involved in high_x000D_ glucose-induced epithelial to mesenchymal transition in renal tubular epithelial _x000D_ cells. Biochem Biophys Res Commun. 2015 Dec 4-11;468(1-2):281-6. doi:_x000D_ 10.1016/j.bbrc.2015.10.112. Epub 2015 Oct 24. PubMed PMID: 26505798.
9: Nath A, Li I, Roberts LR, Chan C. Elevated free fatty acid uptake via CD36_x000D_ promotes epithelial-mesenchymal transition in hepatocellular carcinoma. Sci Rep. _x000D_ 2015 Oct 1;5:14752. doi: 10.1038/srep14752. PubMed PMID: 26424075; PubMed Central_x000D_ PMCID: PMC4589791.
10: Sundaresan S, Abumrad NA. Dietary Lipids Inform the Gut and Brain about Meal _x000D_ Arrival via CD36-Mediated Signal Transduction. J Nutr. 2015 Oct;145(10):2195-200._x000D_ doi: 10.3945/jn.115.215483. Epub 2015 Aug 12. Review. PubMed PMID: 26269236;_x000D_ PubMed Central PMCID: PMC4580959.
11: Schörghofer D, Kinslechner K, Preitschopf A, Schütz B, Röhrl C,_x000D_ Hengstschläger M, Stangl H, Mikula M. The HDL receptor SR-BI is associated with_x000D_ human prostate cancer progression and plays a possible role in establishing_x000D_ androgen independence. Reprod Biol Endocrinol. 2015 Aug 7;13:88. doi:_x000D_ 10.1186/s12958-015-0087-z. PubMed PMID: 26251134; PubMed Central PMCID:_x000D_ PMC4528807.
12: Allum F, Shao X, Guénard F, Simon MM, Busche S, Caron M, Lambourne J, Lessard_x000D_ J, Tandre K, Hedman ÅK, Kwan T, Ge B; Multiple Tissue Human Expression Resource_x000D_ Consortium., Rönnblom L, McCarthy MI, Deloukas P, Richmond T, Burgess D, Spector _x000D_ TD, Tchernof A, Marceau S, Lathrop M, Vohl MC, Pastinen T, Grundberg E._x000D_ Characterization of functional methylomes by next-generation capture sequencing_x000D_ identifies novel disease-associated variants. Nat Commun. 2015 May 29;6:7211._x000D_ doi: 10.1038/ncomms8211. Erratum in: Nat Commun. 2015;6:8016. PubMed PMID:_x000D_ 26021296; PubMed Central PMCID: PMC4544751.
13: Krzystolik A, Dziedziejko V, Safranow K, Kurzawski G, Rać M, Sagasz-Tysiewicz_x000D_ D, Poncyljusz W, Jakubowska K, Chlubek D, Rać ME. Is plasma soluble CD36_x000D_ associated with cardiovascular risk factors in early onset coronary artery_x000D_ disease patients? Scand J Clin Lab Invest. 2015 Sep;75(5):398-406. doi:_x000D_ 10.3109/00365513.2015.1031693. Epub 2015 Apr 28. PubMed PMID: 25916834.
14: Mrizak I, Šerý O, Plesnik J, Arfa A, Fekih M, Bouslema A, Zaouali M, Tabka Z,_x000D_ Khan NA. The A allele of cluster of differentiation 36 (CD36) SNP 1761667_x000D_ associates with decreased lipid taste perception in obese Tunisian women. Br J_x000D_ Nutr. 2015 Apr 28;113(8):1330-7. doi: 10.1017/S0007114515000343. Epub 2015 Mar_x000D_ 30. PubMed PMID: 25822988.
15: Melis M, Sollai G, Muroni P, Crnjar R, Barbarossa IT. Associations between_x000D_ orosensory perception of oleic acid, the common single nucleotide polymorphisms_x000D_ (rs1761667 and rs1527483) in the CD36 gene, and 6-n-propylthiouracil (PROP)_x000D_ tasting. Nutrients. 2015 Mar 20;7(3):2068-84. doi: 10.3390/nu7032068. PubMed_x000D_ PMID: 25803547; PubMed Central PMCID: PMC4377901.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human CD36 (AA 104-294) Recombinant Protein”

Price and Availability

Earn up to 931 points.

size

Clear

GET A QUOTE NOW

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Cobolimab Biosimilar – Anti-HAVCR2, TIM3, CD366 mAb – Research Grade

PX-TA1544 200€

View product

Human CD36 (AA 104-294) Recombinant Protein

REVIEW YOUR PRODUCT

Cobolimab Biosimilar – Anti-HAVCR2, TIM3, CD366 mAb – Research Grade

Contact us

Cart (0 Items)