Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human CD36 (AA 104-294) Recombinant Protein |
---|---|
Uniprot ID | P16671 |
Uniprot link | http://www.uniprot.org/uniprot/P16671 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MAHNHRHKHKLTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQV RTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAA SFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRF |
Molecular weight | 22,73 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 80% |
Buffer | PBS, imidazole 300mM, Urea 8M, pH7.4 |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Protein Accession | AAA16068.1 |
Spec:Entrez GeneID | 948 |
Spec:NCBI Gene Aliases | CHDS7, GPIV, PASIV, FAT, SCARB3, GP3B, BDPLT10, GP4 |
Spec:SwissProtID | P16671 |
NCBI Reference | AAA16068.1 |
Aliases /Synonyms | CD36 (AA 104-294), antigen CD36, Platelet glycoprotein 4, Fatty acid translocase, FAT, Glycoprotein IIIb, GPIIIB, Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV, GPIV, Thrombospondin receptor, CD_antigen: CD36, GP3B, GP4 |
Reference | PX-P1061 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.