Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human CD137–TNFRSF9-4–1BB recombinant protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human CD137--TNFRSF9-4--1BB recombinant protein |
|---|---|
| Uniprot ID | Q07011 |
| Uniprot link | http://www.uniprot.org/uniprot/Q07011 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQGSHHHHHH |
| Molecular weight | 20.8kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 60% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| Aliases /Synonyms | CD137, CDw137, 4-1BB, ILA, Induced By Lymphocyte Activation, T-cell antigen 4-1BB homolog, Tumor necrosis factor receptor superfamily member 9 |
| Reference | PX-P4059 |
| Note | For research use only |
Related products
Biosimilar
Urelumab Biosimilar – Anti-TNFRSF9, CD137 mAb – Research Grade
PX-TA1265 200€
Biosimilar
Tecaginlimab Biosimilar – Anti-CD40 & CD137 mAb – Research Grade
PX-TA1777 200€
Biosimilar
Rocatinlimab Biosimilar – Anti-CD134 mAb – Research Grade
PX-TA1784 200€
Biosimilar
Pogalizumab Biosimilar – Anti-ACT35 antigen mAb – Research Grade
PX-TA1923 200€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.