Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Human B-Gal Recombinant Protein |
---|---|
Uniprot ID | P16278 |
Uniprot link | http://www.uniprot.org/uniprot/P16278 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHW |
Molecular weight | 74.66KDa |
Purity estimated | 70% |
Buffer | PBS, pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Partial |
Protein Accession | AAA51819.1 |
Spec:Entrez GeneID | 2720 |
Spec:NCBI Gene Aliases | ELNR1, EBP, MPS4B |
Spec:SwissProtID | P16278 |
NCBI Reference | AAA51819.1 |
Aliases /Synonyms | B-Gal, galactosidase, beta 1, beta-D-galactosidase precursor, Beta-galactosidase, GLB1, ELNR1, Acid beta-galactosidase, Lactase, Elastin receptor 1 |
Reference | PX-P2051 |
Note | For research use only |
Publication
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.