Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human B-Gal Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P16278
Molecular weight:
74.66KDa

Original price was: €258.00.Current price is: €210.00.

50ug 19% OFF + 210 loyalty points
Partial
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human B-Gal Recombinant Protein

Product name Human B-Gal Recombinant Protein
Uniprot ID P16278
Uniprot link http://www.uniprot.org/uniprot/P16278
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHW
Molecular weight 74.66KDa
Purity estimated 70%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Protein Accession AAA51819.1
Spec:Entrez GeneID 2720
Spec:NCBI Gene Aliases ELNR1, EBP, MPS4B
Spec:SwissProtID P16278
NCBI Reference AAA51819.1
Aliases /Synonyms B-Gal, galactosidase, beta 1, beta-D-galactosidase precursor, Beta-galactosidase, GLB1, ELNR1, Acid beta-galactosidase, Lactase, Elastin receptor 1
Reference PX-P2051
Note For research use only
Molecular Constructor
Partial
Product name Human B-Gal Recombinant Protein
Uniprot ID P16278
Uniprot link http://www.uniprot.org/uniprot/P16278
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHW
Molecular weight 74.66KDa
Purity estimated 70%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Protein Accession AAA51819.1
Spec:Entrez GeneID 2720
Spec:NCBI Gene Aliases ELNR1, EBP, MPS4B
Spec:SwissProtID P16278
NCBI Reference AAA51819.1
Aliases /Synonyms B-Gal, galactosidase, beta 1, beta-D-galactosidase precursor, Beta-galactosidase, GLB1, ELNR1, Acid beta-galactosidase, Lactase, Elastin receptor 1
Reference PX-P2051
Note For research use only
Molecular Constructor
Partial
Product name PX-P2051-1MG
Uniprot ID P16278
Uniprot link http://www.uniprot.org/uniprot/P16278
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHW
Molecular weight 74.66KDa
Purity estimated 70%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
Protein Accession AAA51819.1
Spec:Entrez GeneID 2720
Spec:NCBI Gene Aliases ELNR1, EBP, MPS4B
Spec:SwissProtID P16278
NCBI Reference AAA51819.1
Aliases /Synonyms B-Gal, galactosidase, beta 1, beta-D-galactosidase precursor, Beta-galactosidase, GLB1, ELNR1, Acid beta-galactosidase, Lactase, Elastin receptor 1
Reference PX-P2051
Note For research use only
Molecular Constructor
Partial

Human B-Gal Recombinant Protein

  • Gao SG, Zeng C, Li LJ, Luo W, Zhang FJ, Tian J, Cheng C, Tu M, Xiong YL, Jiang W, Xu M, Lei GH. Correlation between senescence-associated beta-galactosidase expression in articular cartilage and disease severity of patients with knee osteoarthritis. Int J Rheum Dis. 2016 Mar;19(3):226-32. doi: 10.1111/1756-185X.12096. Epub 2013 Jun 3. PubMed PMID: 26112901.
  • Bidchol AM, Dalal A, Trivedi R, Shukla A, Nampoothiri S, Sankar VH, Danda S, Gupta N, Kabra M, Hebbar SA, Bhat RY, Matta D, Ekbote AV, Puri RD, Phadke SR, Gowrishankar K, Aggarwal S, Ranganath P, Sharda S, Kamate M, Datar CA, Bhat K, Kamath N, Shah H, Krishna S, Gopinath PM, Verma IC, Nagarajaram HA, Satyamoorthy K, Girisha KM. Recurrent and novel GLB1 mutations in India. Gene. 2015 Aug 10;567(2):173-81. doi: 10.1016/j.gene.2015.04.078. Epub 2015 Apr 30. PubMed PMID: 25936995.
  • Regier DS, Tifft CJ. GLB1-Related Disorders. 2013 Oct 17. In: Pagon RA, Adam MP, Ardinger HH, Wallace SE, Amemiya A, Bean LJH, Bird TD, Ledbetter N, Mefford HC, Smith RJH, Stephens K, editors. GeneReviews® [Internet]. Seattle (WA): University of Washington, Seattle; 1993-2017. Available from http://www.ncbi.nlm.nih.gov/books/NBK164500/ PubMed PMID: 24156116.
  • Waszkiewicz N, Szajda SD, Waszkiewicz M, Wojtulewska-Supron A, Szulc A, Kępka A, Chojnowska S, Dadan J, Ładny JR, Zwierz K, Zalewska-Szajda B. The activity of serum beta-galactosidase in colon cancer patients with a history of alcohol and nicotine dependence: preliminary data. Postepy Hig Med Dosw (Online). 2013 Aug 26;67:896-900. PubMed PMID: 24018455.
  • Alexandraki KI, Munayem Khan M, Chahal HS, Dalantaeva NS, Trivellin G, Berney DM, Caron P, Popovic V, Pfeifer M, Jordan S, Korbonits M, Grossman AB. Oncogene-induced senescence in pituitary adenomas and carcinomas. Hormones (Athens). 2012 Jul-Sep;11(3):297-307. PubMed PMID: 22908062.
  • Celtikçi B, Aydın Hİ, Sivri S, Sönmez M, Topçu M, Ozkara HA. Four novel mutations in the β-galactosidase gene identified in infantile type of GM1 gangliosidosis. Clin Biochem. 2012 May;45(7-8):571-4. doi: 10.1016/j.clinbiochem.2011.12.019. Epub 2012 Jan 3. PubMed PMID: 22234367.
  • Skeie JM, Hernandez J, Hinek A, Mullins RF. Molecular responses of choroidal endothelial cells to elastin derived peptides through the elastin-binding protein (GLB1). Matrix Biol. 2012 Mar;31(2):113-9. doi: 10.1016/j.matbio.2011.11.003. Epub 2011 Dec 2. PubMed PMID: 22178079; PubMed Central PMCID: PMC3288713.
  • Ohto U, Usui K, Ochi T, Yuki K, Satow Y, Shimizu T. Crystal structure of human β-galactosidase: structural basis of Gm1 gangliosidosis and morquio B diseases. J Biol Chem. 2012 Jan 13;287(3):1801-12. doi: 10.1074/jbc.M111.293795. Epub 2011 Nov 28. PubMed PMID: 22128166; PubMed Central PMCID: PMC3265862.
  • Fantur KM, Wrodnigg TM, Stütz AE, Pabst BM, Paschke E. Fluorous iminoalditols act as effective pharmacological chaperones against gene products from GLB₁ alleles causing GM1-gangliosidosis and Morquio B disease. J Inherit Metab Dis. 2012 May;35(3):495-503. doi: 10.1007/s10545-011-9409-2. Epub 2011 Oct 28. PubMed PMID: 22033734.
  • Murphy BA, Bunda S, Mitts T, Hinek A. The hyperthermia-enhanced association between tropoelastin and its 67-kDa chaperone results in better deposition of elastic fibers. J Biol Chem. 2010 Dec 17;285(51):40282-93. doi: 10.1074/jbc.M110.169656. Epub 2010 Oct 13. PubMed PMID: 20947500; PubMed Central PMCID: PMC3001008.
  • Yang CF, Wu JY, Tsai FJ. Three novel beta-galactosidase gene mutations in Han Chinese patients with GM1 gangliosidosis are correlated with disease severity. J Biomed Sci. 2010 Sep 30;17:79. doi: 10.1186/1423-0127-17-79. PubMed PMID: 20920281; PubMed Central PMCID: PMC2959015.
  • Li L, Higaki K, Ninomiya H, Luan Z, Iida M, Ogawa S, Suzuki Y, Ohno K, Nanba E. Chemical chaperone therapy: luciferase assay for screening of β-galactosidase mutations. Mol Genet Metab. 2010 Dec;101(4):364-9. doi: 10.1016/j.ymgme.2010.08.012. Epub 2010 Aug 18. PubMed PMID: 20826101.
  • Hofer D, Paul K, Fantur K, Beck M, Roubergue A, Vellodi A, Poorthuis BJ, Michelakakis H, Plecko B, Paschke E. Phenotype determining alleles in GM1 gangliosidosis patients bearing novel GLB1 mutations. Clin Genet. 2010 Sep;78(3):236-46. doi: 10.1111/j.1399-0004.2010.01379.x. Epub 2010 Feb 11. PubMed PMID: 20175788.
  • Antonicelli F, Bellon G, Lorimier S, Hornebeck W. Role of the elastin receptor complex (S-Gal/Cath-A/Neu-1) in skin repair and regeneration. Wound Repair Regen. 2009 Sep-Oct;17(5):631-8. doi: 10.1111/j.1524-475X.2009.00525.x. PubMed PMID: 19769716.
  • Hofer D, Paul K, Fantur K, Beck M, Bürger F, Caillaud C, Fumic K, Ledvinova J, Lugowska A, Michelakakis H, Radeva B, Ramaswami U, Plecko B, Paschke E. GM1 gangliosidosis and Morquio B disease: expression analysis of missense mutations affecting the catalytic site of acid beta-galactosidase. Hum Mutat. 2009 Aug;30(8):1214-21. doi: 10.1002/humu.21031. PubMed PMID: 19472408.
  • Mayer FQ, Pereira Fdos S, Fensom AH, Slade C, Matte U, Giugliani R. New GLB1 mutation in siblings with Morquio type B disease presenting with mental regression. Mol Genet Metab. 2009 Mar;96(3):148. doi: 10.1016/j.ymgme.2008.11.159. Epub 2008 Dec 16. PubMed PMID: 19091613.

There are no reviews yet.

Be the first to review “Human B-Gal Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products