Brand: ProteoGenix

Histamine H1 receptor(HRH1)

PX-P4596-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Uniprot ID:: P35367

Original price was: €209.00.Current price is: €182.00.

50ug 13% OFF + 182 loyalty points

Lys212–Gln416

Size Size

50ug Original price was: €209.00.Current price is: €182.00.
100ug Original price was: €398.00.Current price is: €329.00.
1MG Original price was: €1,145.00.Current price is: €954.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Histamine H1 receptor(HRH1)

Product name	Histamine H1 receptor(HRH1)
Uniprot ID	P35367
Uniprot link	http://www.uniprot.org/uniprot/P35367
Expression system	Prokaryotic expression
Raw Antigen Sequence	KIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQL
Purity estimated	>90% by SDS-PAGE
Buffer	0.02% Sarcosyl+PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Lys212-Gln416
Aliases /Synonyms	HRH1,H1R,HH1R
Reference	PX-P4596
Note	For research use only
Molecular Constructor	Lys212–Gln416

Product name	Histamine H1 receptor(HRH1)
Uniprot ID	P35367
Uniprot link	http://www.uniprot.org/uniprot/P35367
Expression system	Prokaryotic expression
Raw Antigen Sequence	KIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQL
Purity estimated	>90% by SDS-PAGE
Buffer	0.02% Sarcosyl+PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Lys212-Gln416
Aliases /Synonyms	HRH1,H1R,HH1R
Reference	PX-P4596
Note	For research use only
Molecular Constructor	Lys212–Gln416

Product name	PX-P4596-1MG
Uniprot ID	P35367
Uniprot link	http://www.uniprot.org/uniprot/P35367
Expression system	Prokaryotic expression
Raw Antigen Sequence	KIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQL
Purity estimated	>90% by SDS-PAGE
Buffer	0.02% Sarcosyl+PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Lys212-Gln416
Aliases /Synonyms	HRH1,H1R,HH1R
Reference	PX-P4596
Note	For research use only
Molecular Constructor	Lys212–Gln416

General Information about Histamine H1 receptor (HRH1)

In the surrounding tissues, the H1 subclass of histamine receptors mediate the contraction of smooth muscles, the increase in capillary permeability due to the contraction of peripheral venules, the release of catecholamines from the adrenal medulla, and mediate the central nervous system Nerve transmission.