Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Drosophila TSH Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameDrosophila TSH Recombinant Protein
Uniprot IDP22265
Uniprot linkhttp://www.uniprot.org/uniprot/P22265
Origin speciesDrosophila
Expression systemProkaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSANSSERCPS HDSNSSEHGGGAGSGGVGHRLDAAALSTGVMPGEGPTTLHSSFPAVPQSLPSQPPSMEAYLHMVAAAAQQYGFPLAAAAA AGAGPRLPLPLANEAAAPFKLPPQASPTASSNNSEALDFRTNLYGRAESAEPPASEGEEEEFDDGANNPLDLSVGTRKRG HESEPQLGHIQVKKMFKSD
Molecular weight46,03 kDa
Protein delivered with Tag?No
Purity estimated80%
Buffer3C-protease cleavage buffer: TrisHC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAA28983.1
Spec:Entrez GeneID35430
Spec:NCBI Gene AliasesCG1374, ae, Tsh, T shirt, l(2)B4-2-12, l(2)04319, ae[l], DmelCG1374
Spec:SwissProtIDP22265
NCBI ReferenceAAA28983.1
Aliases /SynonymsTSH, teashirt, Protein teashirt, CG1374
ReferencePX-P1054
NoteFor research use only

Description of Drosophila TSH Recombinant Protein

General information on Drosophila TSH Recombinant Protein:

Protein teashirt from Drosophila melanogaster (Fruit fly) also known as TSH is initially localized in the cytoplasm soon after the blastoderm stage, and becomes nuclear by stage 9. It belongs to the teashirt C2H2-type zinc-finger protein family. It is a homeotic protein that acts downstream of Arm in the Wg cascade during embryogenesis to determine segment identity throughout the entire trunk. The protein shows a dynamic expression pattern during embryogenesis, expressed throughout embryonic, larval and adult development. TSH may play a role in wing hinge development. Possible involvement in chromatin structure for modulation of transcription. Binds DNA and can act as both a transcriptional repressor and activator.

Publication

1: Fasano L, Röder L, Coré N, Alexandre E, Vola C, Jacq B, Kerridge S. The gene teashirt is required for the development of Drosophila embryonic trunk segments and encodes a protein with widely spaced zinc finger motifs. Cell. 1991 Jan 11;64(1):63-79. PubMed PMID: 1846092.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Drosophila TSH Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products