Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameDisintegrin and metalloproteinase domain-containing protein 10(ADAM10)
Uniprot IDO14672
Uniprot linkhttps://www.uniprot.org/uniprot/O14672
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceTTSAEKYTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKD PTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKS LNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNN NKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGK QCS
Molecular weight32.34 kDa
Protein delivered with Tag?N terminus His tag
Purity estimated>90% by SDS-PAGE
BufferPBS pH 7.5, 0.02% SKL
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeThr214-Ser504
Protein AccessionO14672
Spec:Entrez GeneID102
Spec:NCBI Gene AliasesRAK; kuz; AD10; AD18; MADM; CD156c; CDw156; HsT18717
Spec:SwissProtIDQ92650
NCBI ReferenceO14672
Aliases /SynonymsADAM 10,CDw156,Kuzbanian protein homolog,Mammalian disintegrin-metalloprotease,CD_antigen: CD156c,KUZ, MADM
ReferencePX-P4796
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Disintegrin and metalloproteinase domain-containing protein 10(ADAM10)”

Your email address will not be published. Required fields are marked *

Related products

Anti His tag mouse monoclonal antibody
Tag Antibody

Anti His tag mouse monoclonal antibody

PTX17851 180€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products