Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Chilli Ca_eIF4E1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Chilli
Uniprot ID:
Q8GSF9
Molecular weight:
28,15 kDa

Original price was: €250.00.Current price is: €210.00.

50ug 16% OFF + 210 loyalty points
Full-length Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Chilli Ca_eIF4E1 Recombinant Protein

Product name Chilli Ca_eIF4E1 Recombinant Protein
Uniprot ID Q8GSF9
Uniprot link http://www.uniprot.org/uniprot/Q8GSF9
Origin species Chilli
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMMATAEMEKTTTFDEAEKVKLNANEADDEVEEGEIVEETDDTTSYLSKEIATKHPLEHSW TFWFDNPVAKSKQAAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLVVGADLHCFKHKIEPKWEDPVCANGGTWKMSFSKG KSDTSWLYTLLAMIGHQFDHEDEICGAVVSVRGKGEKISLWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLD RNAKNRYTV
Molecular weight 28,15 kDa
Protein delivered with Tag? Yes
Purity estimated ≥90%
Buffer PBS1x, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession AAN74644.1
Spec:SwissProtID Q8GSF9
NCBI Reference AAN74644.1
Aliases /Synonyms Ca_eIF4E1, eucaryotic initiation factor 4E, Eukaryotic translation initiation factor 4E
Reference PX-P1077
Note For research use only
Molecular Constructor
Full-length Yes
Product name Chilli Ca_eIF4E1 Recombinant Protein
Uniprot ID Q8GSF9
Uniprot link http://www.uniprot.org/uniprot/Q8GSF9
Origin species Chilli
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMMATAEMEKTTTFDEAEKVKLNANEADDEVEEGEIVEETDDTTSYLSKEIATKHPLEHSW TFWFDNPVAKSKQAAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLVVGADLHCFKHKIEPKWEDPVCANGGTWKMSFSKG KSDTSWLYTLLAMIGHQFDHEDEICGAVVSVRGKGEKISLWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLD RNAKNRYTV
Molecular weight 28,15 kDa
Protein delivered with Tag? Yes
Purity estimated ≥90%
Buffer PBS1x, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession AAN74644.1
Spec:SwissProtID Q8GSF9
NCBI Reference AAN74644.1
Aliases /Synonyms Ca_eIF4E1, eucaryotic initiation factor 4E, Eukaryotic translation initiation factor 4E
Reference PX-P1077
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P1077-1MG
Uniprot ID Q8GSF9
Uniprot link http://www.uniprot.org/uniprot/Q8GSF9
Origin species Chilli
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMMATAEMEKTTTFDEAEKVKLNANEADDEVEEGEIVEETDDTTSYLSKEIATKHPLEHSW TFWFDNPVAKSKQAAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLVVGADLHCFKHKIEPKWEDPVCANGGTWKMSFSKG KSDTSWLYTLLAMIGHQFDHEDEICGAVVSVRGKGEKISLWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLD RNAKNRYTV
Molecular weight 28,15 kDa
Protein delivered with Tag? Yes
Purity estimated ≥90%
Buffer PBS1x, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession AAN74644.1
Spec:SwissProtID Q8GSF9
NCBI Reference AAN74644.1
Aliases /Synonyms Ca_eIF4E1, eucaryotic initiation factor 4E, Eukaryotic translation initiation factor 4E
Reference PX-P1077
Note For research use only
Molecular Constructor
Full-length Yes

General information on Chilli Ca_eIF4E1 Recombinant Protein:

eIF4E1 Recombinant Protein from Capsicum annuum (Bell pepper) is a central element of the initiation complex of mRNA translation in eukaryotes. The eIF4E gene is coexpressed with the Tobacco etch virus (TEV) genome, it exerts a positive effect on viral amplification.

Chilli Ca_eIF4E1 Recombinant Protein

  • Charron C, Nicolaï M, Gallois JL, Robaglia C, Moury B, Palloix A, Caranta C. Natural variation and functional analyses provide evidence for co-evolution between plant eIF4E and potyviral VPg. Plant J. 2008 Apr;54(1):56-68. doi: 10.1111/j.1365-313X.2008.03407.x. Epub 2008 Jan 7. PubMed PMID: 18182024.
  • Kang BC, Yeam I, Frantz JD, Murphy JF, Jahn MM. The pvr1 locus in Capsicum encodes a translation initiation factor eIF4E that interacts with Tobacco etch virus VPg. Plant J. 2005 May;42(3):392-405. PubMed PMID: 15842624.
  • Ruffel S, Dussault MH, Palloix A, Moury B, Bendahmane A, Robaglia C, Caranta C. A natural recessive resistance gene against potato virus Y in pepper corresponds to the eukaryotic initiation factor 4E (eIF4E). Plant J. 2002 Dec;32(6):1067-75. PubMed PMID: 12492847.

There are no reviews yet.

Be the first to review “Chilli Ca_eIF4E1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products