Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Chilli Ca_eIF4E1 Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameChilli Ca_eIF4E1 Recombinant Protein
Uniprot IDQ8GSF9
Uniprot linkhttp://www.uniprot.org/uniprot/Q8GSF9
Origin speciesChilli
Expression systemProkaryotic expression
SequenceMGSSHHHHHHSSGLVPRGSHMMATAEMEKTTTFDEAEKVKLNANEADDEVEEGEIVEETDDTTSYLSKEIATKHPLEHSW TFWFDNPVAKSKQAAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLVVGADLHCFKHKIEPKWEDPVCANGGTWKMSFSKG KSDTSWLYTLLAMIGHQFDHEDEICGAVVSVRGKGEKISLWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLD RNAKNRYTV
Molecular weight28,15 kDa
Protein delivered with Tag?Yes
Purity estimated≥90%
BufferPBS1x, Urea 8M
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionAAN74644.1
Spec:SwissProtIDQ8GSF9
NCBI ReferenceAAN74644.1
Aliases /SynonymsCa_eIF4E1, eucaryotic initiation factor 4E, Eukaryotic translation initiation factor 4E
ReferencePX-P1077
NoteFor research use only

Description of Chilli Ca_eIF4E1 Recombinant Protein

General information on Chilli Ca_eIF4E1 Recombinant Protein:

eIF4E1 Recombinant Protein from Capsicum annuum (Bell pepper) is a central element of the initiation complex of mRNA translation in eukaryotes. The eIF4E gene is coexpressed with the Tobacco etch virus (TEV) genome, it exerts a positive effect on viral amplification.

Publication

1: Charron C, Nicolaï M, Gallois JL, Robaglia C, Moury B, Palloix A, Caranta C. Natural variation and functional analyses provide evidence for co-evolution between plant eIF4E and potyviral VPg. Plant J. 2008 Apr;54(1):56-68. doi: 10.1111/j.1365-313X.2008.03407.x. Epub 2008 Jan 7. PubMed PMID: 18182024. 2: Kang BC, Yeam I, Frantz JD, Murphy JF, Jahn MM. The pvr1 locus in Capsicum encodes a translation initiation factor eIF4E that interacts with Tobacco etch virus VPg. Plant J. 2005 May;42(3):392-405. PubMed PMID: 15842624. 3: Ruffel S, Dussault MH, Palloix A, Moury B, Bendahmane A, Robaglia C, Caranta C. A natural recessive resistance gene against potato virus Y in pepper corresponds to the eukaryotic initiation factor 4E (eIF4E). Plant J. 2002 Dec;32(6):1067-75. PubMed PMID: 12492847.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Chilli Ca_eIF4E1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products