Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Chilli Ca_eIF4E1 Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameChilli Ca_eIF4E1 Recombinant Protein
Uniprot IDQ8GSF9
Uniprot linkhttp://www.uniprot.org/uniprot/Q8GSF9
Origin speciesChilli
Expression systemProkaryotic expression
SequenceMGSSHHHHHHSSGLVPRGSHMMATAEMEKTTTFDEAEKVKLNANEADDEVEEGEIVEETDDTTSYLSKEIATKHPLEHSW TFWFDNPVAKSKQAAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLVVGADLHCFKHKIEPKWEDPVCANGGTWKMSFSKG KSDTSWLYTLLAMIGHQFDHEDEICGAVVSVRGKGEKISLWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLD RNAKNRYTV
Molecular weight28,15 kDa
Protein delivered with Tag?Yes
Purity estimated≥90%
BufferPBS1x, Urea 8M
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionAAN74644.1
Spec:SwissProtIDQ8GSF9
NCBI ReferenceAAN74644.1
Aliases /SynonymsCa_eIF4E1, eucaryotic initiation factor 4E, Eukaryotic translation initiation factor 4E
ReferencePX-P1077
NoteFor research use only

Description of Chilli Ca_eIF4E1 Recombinant Protein

General information on Chilli Ca_eIF4E1 Recombinant Protein:

eIF4E1 Recombinant Protein from Capsicum annuum (Bell pepper) is a central element of the initiation complex of mRNA translation in eukaryotes. The eIF4E gene is coexpressed with the Tobacco etch virus (TEV) genome, it exerts a positive effect on viral amplification.

Publication

  • 1: Charron C, Nicolaï M, Gallois JL, Robaglia C, Moury B, Palloix A, Caranta C. Natural variation and functional analyses provide evidence for co-evolution between plant eIF4E and potyviral VPg. Plant J. 2008 Apr;54(1):56-68. doi: 10.1111/j.1365-313X.2008.03407.x. Epub 2008 Jan 7. PubMed PMID: 18182024.
  • 2: Kang BC, Yeam I, Frantz JD, Murphy JF, Jahn MM. The pvr1 locus in Capsicum encodes a translation initiation factor eIF4E that interacts with Tobacco etch virus VPg. Plant J. 2005 May;42(3):392-405. PubMed PMID: 15842624.
  • 3: Ruffel S, Dussault MH, Palloix A, Moury B, Bendahmane A, Robaglia C, Caranta C. A natural recessive resistance gene against potato virus Y in pepper corresponds to the eukaryotic initiation factor 4E (eIF4E). Plant J. 2002 Dec;32(6):1067-75. PubMed PMID: 12492847.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Chilli Ca_eIF4E1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products