Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

CD47 Recombinant Protein (Human)

Reference: PX-P4083-100
size

100ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Mammalian cells

Applications

Elisa, WB

Product nameCD47 Recombinant Protein (Human)
Uniprot IDQ08722
Uniprot linkhttp://www.uniprot.org/uniprot/Q08722
Origin speciesHomo sapiens (Human)
Expression systemEukaryotic expression
SequenceMWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDK SDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
Molecular weight35kDa
Protein delivered with Tag?C-terminal His Tag
Purity estimated>90% by SDS-PAGE
BufferPBS pH7.5
Delivery conditionDry Ice
Delivery lead time in business days3-5 days if in stock; 3-5 weeks if production needed
Storage conditionStore at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
BrandProteoGenix
Host speciesMammalian cells
Fragment TypeMet1~Glu141
Aliases /SynonymsMER6
ReferencePX-P4083
NoteFor research use only.

Description of CD47 Recombinant Protein (Human)

General Information about CD47 Recombinant Protein

CD47 (Cluster of Differentiation 47), also known as the integrin associated protein (IAP), is a transmembrane protein which is encoded by the CD47 gene in humans. CD47 belongs to the immunoglobulin superfamily and binds to membrane integrins, as well as thrombospondin 1 (TSP-1) ligands and α signal regulatory protein (SIRPα).
CD47 is involved in a variety of cellular processes, including apoptosis, proliferation, adhesion, and migration. In addition, it plays a key role in immune and angiogenic reactions. CD47 is commonly expressed in human cells and has been shown to overexpress in many different tumor cells. It is also expressed in assorted cranial tumors.
CD47 is a membrane receptor with an extracellular N-terminal IgV domain, five transmembrane domains, and a short, C-terminal intracellular tail.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “CD47 Recombinant Protein (Human)”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products