Cart (0 Items)
Your cart is currently empty.
View Products
              
              
              | size | 100ug  | 
		
|---|---|
| Brand | ProteoGenix  | 
		
| Product type | Recombinant Proteins  | 
		
| Host Species | Mammalian cells  | 
		
| Applications | Elisa, WB  | 
		
| Product name | CD28 Recombinant Protein | 
|---|---|
| Uniprot ID | P10747 | 
| Uniprot link | http://www.uniprot.org/uniprot/P10747 | 
| Origin species | Homo sapiens (Human) | 
| Expression system | Eukaryotic expression | 
| Sequence | MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP | 
| Molecular weight | 42.63KDa | 
| Protein delivered with Tag? | C-terminal Fc Tag | 
| Purity estimated | >90% by SDS-PAGE | 
| Buffer | PBS pH7.5 | 
| Delivery condition | Dry Ice | 
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. | 
| Brand | ProteoGenix | 
| Host species | Mammalian cells | 
| Fragment Type | Met1~Pro152 | 
| Aliases /Synonyms | / | 
| Reference | PX-P4080 | 
| Note | For research use only | 
CD28 (Cluster of Differentiation 28) belongs to the immunoglobulin (Ig) superfamily. It is a glycoprotein linked to dyslipidemia. It is structurally composed of a single Ig V-like extracellular domain, transmembrane domain and intracellular domain. Mouse CD28 is structurally expressed on the surface of all parietal cells and developing thymocytes in the form of disulfide-bound homodimers or monomers. CD28 can bind B7-1 and B7-2 ligands and together play an important role in the response of T lymphocytes and B lymphocytes and tolerance of peripheral cells. Thus, CD28 is involved in the activation of T cells, the induction of cell proliferation, the production of cytokines and the acceleration of T cell survival.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.