Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD265 Recombinant Protein |
---|---|
Uniprot ID | Q9Y6Q6 |
Uniprot link | http://www.uniprot.org/uniprot/Q9Y6Q6 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MAPRARRRRPLFALLLLCALLARLQVALQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP |
Molecular weight | 25-28kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >95% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1-Pro212 |
Aliases /Synonyms | ODFR |
Reference | PX-P4124 |
Note | For research use only |
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.