Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD160 antigen(1-158) |
|---|---|
| Uniprot ID | O95971 |
| Uniprot link | https://www.uniprot.org/uniprot/O95971 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH |
| Molecular weight | 22.52kDa |
| Purity estimated | >70% by SDS-PAGE |
| Buffer | PBS, pH=7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Leu158 |
| Aliases /Synonyms | Natural killer cell receptor BY55,CD_antigen: CD160,BY55,CD160-TM |
| Reference | PX-P4287 |
| Note | For research use only. |
The CD160 antigen is a protein encoded by the CD160 gene in humans. CD160 is a glycoprotein that was originally identified with the monoclonal antibody BY55. Its expression is strictly related to peripheral blood NK cells and cytolytically active CD8 T lymphocytes. The CD160 cDNA sequence can be predicted to be rich in 18-colored glycosylphosphatidylinositol amino acids, with a single Ig-like domain that is weakly homologous to the KIR2DL4 molecule. CD160 is expressed on the cell surface as a multimer with tightly bound disulfide bonds. Northern blot analysis showed that the CD160 mRNA was 1.5 and 1.6 kb, and its expression was very limited to circulating NK and T cells, spleen, and small intestine. In NK cells, CD160 is expressed by CD56dimCD16 + cells, while in circulating T cells, its expression is mainly limited to cells carrying TCRgd and TCRab + CD8brightCD95 + CD56 + CD28-CD27-CD27 cells. In tissue, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 exhibits broad specificity for the binding of classical and unconventional MHC class I molecules.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.