Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD160 antigen (1-179) |
---|---|
Uniprot ID | O95971 |
Uniprot link | https://www.uniprot.org/uniprot/O95971 |
Expression system | Eukaryotic expression |
Sequence | MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH |
Molecular weight | 22.52kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >70% by SDS-PAGE |
Buffer | PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Mer1-Gln179 |
Protein Accession | O95971 |
Spec:Entrez GeneID | 11126 |
Spec:NCBI Gene Aliases | NK1; BY55; NK28 |
Spec:SwissProtID | Q5T2V6 |
NCBI Reference | O95971 |
Aliases /Synonyms | Natural killer cell receptor BY55 / CD_antigen: CD160 |
Reference | PX-P4469 |
Note | For research use only |
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.