Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD121a Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P14778
Molecular weight:
64.3KDa

Original price was: €207.00.Current price is: €188.00.

50ug 9% OFF + 188 loyalty points
Met1~Thr332 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD121a Recombinant Protein

Product name PX-P4101-100
Uniprot ID P14778
Uniprot link http://www.uniprot.org/uniprot/P14778
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
Molecular weight 64.3KDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Thr332
Protein Accession P14778
Spec:Entrez GeneID 3554
Spec:NCBI Gene Aliases P80; IL1R; IL1RA; CD121A; D2S1473; IL-1R-alpha
Spec:SwissProtID Q587I7
NCBI Reference P14778
Aliases /Synonyms IL1R, IL1RA, IL1RT1
Reference PX-P4101
Note For research use only
Molecular Constructor
Met1~Thr332 Fc
Product name PX-P4101-1MG
Uniprot ID P14778
Uniprot link http://www.uniprot.org/uniprot/P14778
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
Molecular weight 64.3KDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Thr332
Protein Accession P14778
Spec:Entrez GeneID 3554
Spec:NCBI Gene Aliases P80; IL1R; IL1RA; CD121A; D2S1473; IL-1R-alpha
Spec:SwissProtID Q587I7
NCBI Reference P14778
Aliases /Synonyms IL1R, IL1RA, IL1RT1
Reference PX-P4101
Note For research use only
Molecular Constructor
Met1~Thr332 Fc
Product name PX-P4101-50
Uniprot ID P14778
Uniprot link http://www.uniprot.org/uniprot/P14778
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
Molecular weight 64.3KDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Thr332
Protein Accession P14778
Spec:Entrez GeneID 3554
Spec:NCBI Gene Aliases P80; IL1R; IL1RA; CD121A; D2S1473; IL-1R-alpha
Spec:SwissProtID Q587I7
NCBI Reference P14778
Aliases /Synonyms IL1R, IL1RA, IL1RT1
Reference PX-P4101
Note For research use only
Molecular Constructor
Met1~Thr332 Fc

CD121a Recombinant Protein

There are no reviews yet.

Be the first to review “CD121a Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products