Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Bifidobacterium longum Amidase Recombinant Protein |
|---|---|
| Uniprot link | https://www.uniprot.org/uniprot/ |
| Origin species | Bifidobacterium longum |
| Expression system | Prokaryotic expression |
| Sequence | MGCVGGLAFSSAQPAQADTYSDLINAQNQHAASVQREAELKQQLAGASQDLANKVLELDDLTNNKIVAAQAKVTQANEDAATAQDEADAASGRLSAAQKDKETLEEQIKQTGKDYDDAHAAVAQLARDEMHGSNASDVMSVVTGATSTQDFVNSMQSRDALSRNEANAASSAATSLSTSKNRGERLAAIEKQIAVLKTQADEKAASAQTAAETAQSERDALDKLRQEGEARRDELSSMIDSLDSQSAKQAAQTVLIASQVDSYNRQFQKEQQDAANRVDTGNQGGTPSTPVTPAPAPAPAPAPAPAPAPAPSVGGQGTSNGDYGNAYATGQCTYWAYERRRQMGIGTPSYLGNGGDWWRNAPSYGLRVDHNPQVGAALSFLPGQDGADGTWGHVAVVEAVYGDGTFQISEMNVGGLWMMNYRTLTNLGQYWFVHGSHHHHHH |
| Molecular weight | 46.76kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 70% |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 2-3 |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| NCBI Reference | WP_032737268.1 |
| Reference | PX-P4064 |
| Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.