Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Bifidobacterium longum Amidase Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Bifidobacterium longum Amidase Recombinant Protein |
|---|---|
| Uniprot link | https://www.uniprot.org/uniprot/ |
| Origin species | Bifidobacterium longum |
| Expression system | Prokaryotic expression |
| Sequence | MGCVGGLAFSSAQPAQADTYSDLINAQNQHAASVQREAELKQQLAGASQDLANKVLELDDLTNNKIVAAQAKVTQANEDAATAQDEADAASGRLSAAQKDKETLEEQIKQTGKDYDDAHAAVAQLARDEMHGSNASDVMSVVTGATSTQDFVNSMQSRDALSRNEANAASSAATSLSTSKNRGERLAAIEKQIAVLKTQADEKAASAQTAAETAQSERDALDKLRQEGEARRDELSSMIDSLDSQSAKQAAQTVLIASQVDSYNRQFQKEQQDAANRVDTGNQGGTPSTPVTPAPAPAPAPAPAPAPAPAPSVGGQGTSNGDYGNAYATGQCTYWAYERRRQMGIGTPSYLGNGGDWWRNAPSYGLRVDHNPQVGAALSFLPGQDGADGTWGHVAVVEAVYGDGTFQISEMNVGGLWMMNYRTLTNLGQYWFVHGSHHHHHH |
| Molecular weight | 46.76kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 70% |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 2-3 |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| NCBI Reference | WP_032737268.1 |
| Reference | PX-P4064 |
| Note | For research use only |
Related products
Biosimilar
Agalsidase Alfa Biosimilar – Alpha-D-galactosidase A – Research Grade
PX-TA1908 200€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.