Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Plasmodium falciparum MSA2/MSP2 Antibody (4D11)

Original price was: €329.00.Current price is: €272.00.

50ug 17% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Plasmodium falciparum MSA2/MSP2 Antibody (4D11)

Product name ARO-A14970-100
Uniprot ID P50498
Raw Antigen Sequence MKVIKTLSIINFFIFVTFNIKNESKYSNTFINNAYNMSIRRSMAESKPSTGAGGSAGGSAGGSAGGSAGGSAGGSAGSGDGNGADAEGSSSTPATTTTTKTTTTTTTTNDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNNSSNIASINKFVVLISATLVLSFAIFI
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Plasmodium falciparum (isolate 3D7)
Reference ARO-A14970
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Merozoite surface antigen 2, MSA-2, 45 kDa merozoite surface antigen, MSA2, PFB0300c, Parasite
Target species Anti-Plasmodium falciparum (isolate 3D7) Monoclonal Antibody
Product name ARO-A14970-1MG
Uniprot ID P50498
Raw Antigen Sequence MKVIKTLSIINFFIFVTFNIKNESKYSNTFINNAYNMSIRRSMAESKPSTGAGGSAGGSAGGSAGGSAGGSAGGSAGSGDGNGADAEGSSSTPATTTTTKTTTTTTTTNDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNNSSNIASINKFVVLISATLVLSFAIFI
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Plasmodium falciparum (isolate 3D7)
Reference ARO-A14970
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Merozoite surface antigen 2, MSA-2, 45 kDa merozoite surface antigen, MSA2, PFB0300c, Parasite
Target species Anti-Plasmodium falciparum (isolate 3D7) Monoclonal Antibody
Product name ARO-A14970-50
Uniprot ID P50498
Raw Antigen Sequence MKVIKTLSIINFFIFVTFNIKNESKYSNTFINNAYNMSIRRSMAESKPSTGAGGSAGGSAGGSAGGSAGGSAGGSAGSGDGNGADAEGSSSTPATTTTTKTTTTTTTTNDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNNSSNIASINKFVVLISATLVLSFAIFI
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Plasmodium falciparum (isolate 3D7)
Reference ARO-A14970
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Merozoite surface antigen 2, MSA-2, 45 kDa merozoite surface antigen, MSA2, PFB0300c, Parasite
Target species Anti-Plasmodium falciparum (isolate 3D7) Monoclonal Antibody

Anti-Plasmodium falciparum MSA2/MSP2 Antibody (4D11)

There are no reviews yet.

Be the first to review “Anti-Plasmodium falciparum MSA2/MSP2 Antibody (4D11)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products