Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Isotype | IgG |
| Brand | ProteoGenix |
| Product type | COVID-19 products |
| Host Species | Rabbit |
| Clonality | Polyclonal Antibody |
| Applications | Elisa |
| Product name | Anti-ORF7a protein polyclonal antibody |
|---|---|
| Source | P0DTC7 |
| Species | SARS-CoV-2 |
| Molecular weight | 13kDa |
| Buffer | PBS, pH7.4, containing 0.05% proclin300, 50% glycerol |
| Form | Liquid |
| Delivery condition | Blue ice (+4°C) |
| Storage condition | 4°C for short term; -20°c or -80°C for long term |
| Brand | Proteogenix |
| Host species | Rabbit |
| Aliases – Synonyms | ORF7a protein |
| Size | 100ug |
| Reference | PTXCOV-A559 |
| Note | For research use and in vitro diagnostic only. Not suitable for human use. |
| Isotype | IgG |
| Clonality | Polyclonal Antibody |
| Target | ORF7a: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE |
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.