Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Isotype | IgG |
Brand | ProteoGenix |
Product type | COVID-19 products |
Host Species | Rabbit |
Clonality | Polyclonal Antibody |
Applications | Elisa |
Product name | Anti-ORF7a protein polyclonal antibody |
---|---|
Source | P0DTC7 |
Species | SARS-CoV-2 |
Molecular weight | 13kDa |
Buffer | PBS, pH7.4, containing 0.05% proclin300, 50% glycerol |
Form | Liquid |
Delivery condition | Blue ice (+4°C) |
Storage condition | 4°C for short term; -20°c or -80°C for long term |
Brand | Proteogenix |
Host species | Rabbit |
Aliases – Synonyms | ORF7a protein |
Size | 100ug |
Reference | PTXCOV-A559 |
Note | For research use and in vitro diagnostic only. Not suitable for human use. |
Isotype | IgG |
Clonality | Polyclonal Antibody |
Target | ORF7a: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE |
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.