Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-ORF7a protein polyclonal antibody

  • PTXCOV-A559-50
  • Validated WB
Note:
For research use and in vitro diagnostic only. Not suitable for human use.

Original price was: €146.00.Current price is: €118.00.

50ug 19% OFF + 118 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-ORF7a protein polyclonal antibody binds to Recombinant SARS-CoV-2 ORF7a/Protein U122 Protein, N-His in WB Assay
Anti-ORF7a protein polyclonal antibody

Anti-ORF7a protein polyclonal antibody

Product name PTXCOV-A559-100
Uniprot ID P0DTC7
Source P0DTC7
Species SARS-CoV-2
Raw Antigen Sequence ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELY
Molecular weight 13kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms ORF7a protein
Size 100ug
Reference PTXCOV-A559
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target ORF7a: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
Product name PTXCOV-A559-1MG
Uniprot ID P0DTC7
Source P0DTC7
Species SARS-CoV-2
Raw Antigen Sequence ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELY
Molecular weight 13kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms ORF7a protein
Size 100ug
Reference PTXCOV-A559
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target ORF7a: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
Product name PTXCOV-A559-50
Uniprot ID P0DTC7
Source P0DTC7
Species SARS-CoV-2
Raw Antigen Sequence ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELY
Molecular weight 13kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms ORF7a protein
Size 100ug
Reference PTXCOV-A559
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target ORF7a: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE

Anti-ORF7a protein polyclonal antibody binds to Recombinant SARS-CoV-2 ORF7a/Protein U122 Protein, N-His in WB Assay

Anti-ORF7a protein polyclonal antibody binds to Recombinant SARS-CoV-2 ORF7a/Protein U122 Protein, N-His in WB Assay

Recombinant SARS-CoV-2 ORF7a/Protein U122 Protein, N-His(cat. No.ARO-P16917) can bind Anti-ORF7a protein polyclonal antibody in Western Blot Assay as detected on gel analysis.

Anti-ORF7a protein polyclonal antibody

There are no reviews yet.

Be the first to review “Anti-ORF7a protein polyclonal antibody”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products