Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)

  • ARO-A14959-50
  • Validated ELISA

Original price was: €356.00.Current price is: €272.00.

50ug 24% OFF + 272 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SEC-HPLC of Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)
Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)

Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)

Product name ARO-A14959-100
Uniprot ID Q86YL7
Raw Antigen Sequence MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14959
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Podoplanin, Aggrus, Glycoprotein 36, Gp36, PA2.26 antigen, T1-alpha, T1A, 29kDa cytosolic podoplanin intracellular domain, PICD, PDPN, GP36, PSEC0003, PSEC0025
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14959-1MG
Uniprot ID Q86YL7
Raw Antigen Sequence MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14959
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Podoplanin, Aggrus, Glycoprotein 36, Gp36, PA2.26 antigen, T1-alpha, T1A, 29kDa cytosolic podoplanin intracellular domain, PICD, PDPN, GP36, PSEC0003, PSEC0025
Target species Anti-Human Monoclonal Antibody
Product name ARO-A14959-50
Uniprot ID Q86YL7
Raw Antigen Sequence MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A14959
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Podoplanin, Aggrus, Glycoprotein 36, Gp36, PA2.26 antigen, T1-alpha, T1A, 29kDa cytosolic podoplanin intracellular domain, PICD, PDPN, GP36, PSEC0003, PSEC0025
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)

SEC-HPLC of Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)

Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)was analyzed by size exclusion chromatography with UV detection.

Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)

There are no reviews yet.

Be the first to review “Anti-Human/Mouse PDPN/Podoplanin Antibody (SAA0351)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products