Brand: ProteoGenix

Anti-Human GSTO2 Polyclonal Antibody

ARO-A12930-50
Validated WB

Clonality:: Polyclonal Antibody
Host species:: Rabbit

Original price was: €146.00.Current price is: €118.00.

50ug 19% OFF + 118 loyalty points

Size Size

50ug Original price was: €146.00.Current price is: €118.00.
100ug Original price was: €235.00.Current price is: €169.00.
1MG Original price was: €652.00.Current price is: €490.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human GSTO2 Polyclonal Antibody

Product name	ARO-A12930-100
Uniprot ID	Q9H4Y5
Raw Antigen Sequence	MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-Glutathione-dependent dehydroascorbate reductase, Glutathione S-transferase omega 2-2, Monomethylarsonic acid reductase, Glutathione S-transferase omega-2, MMA(V) reductase, GSTO 2-2, GSTO2, GSTO-2
Reference	ARO-A12930
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant Human GSTO2 (Met1-Cys243).

Product name	ARO-A12930-1MG
Uniprot ID	Q9H4Y5
Raw Antigen Sequence	MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-Glutathione-dependent dehydroascorbate reductase, Glutathione S-transferase omega 2-2, Monomethylarsonic acid reductase, Glutathione S-transferase omega-2, MMA(V) reductase, GSTO 2-2, GSTO2, GSTO-2
Reference	ARO-A12930
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant Human GSTO2 (Met1-Cys243).

Product name	ARO-A12930-50
Uniprot ID	Q9H4Y5
Raw Antigen Sequence	MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC
Buffer	0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Rabbit
Aliases /Synonyms	Anti-Glutathione-dependent dehydroascorbate reductase, Glutathione S-transferase omega 2-2, Monomethylarsonic acid reductase, Glutathione S-transferase omega-2, MMA(V) reductase, GSTO 2-2, GSTO2, GSTO-2
Reference	ARO-A12930
Clonality	Polyclonal Antibody
Protein Name	E. coli - derived recombinant Human GSTO2 (Met1-Cys243).

Datasheet

Anti-Human GSTO2 Polyclonal Antibody binds to Recombinant Human GSTO2 Protein, N-His in WB Assay

Recombinant Human GSTO2 Protein, N-His(cat. No.ARO-P10681) can bind Anti-Human GSTO2 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.