Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CD326/EPCAM VHH (SAA1341)

Note:
For research use only. Not suitable for human use.

Original price was: €319.00.Current price is: €266.00.

50ug 17% OFF + 266 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CD326/EPCAM VHH (SAA1341)

Product name ARO-A16451-100
Uniprot ID P16422
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Aliases /Synonyms anti-Epithelial glycoprotein 314, anti-hEGP314, anti-Major gastrointestinal tumor-associated protein GA733-2, anti-EGP314, anti-TACSTD1, anti-Adenocarcinoma-associated antigen, anti-TROP1, anti-EPCAM, anti-Epithelial glycoprotein, anti-KS 1/4 antigen, anti-Tumor-associated calcium signal transducer 1, anti-M4S1, anti-CD326, anti-Ep-CAM, anti-EGP, anti-Epithelial cell adhesion molecule, anti-M1S2, anti-KSA, anti-Cell surface glycoprotein Trop-1, anti-GA733-2, anti-Epithelial cell surface antigen, anti-MIC18
Reference ARO-A16451
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD326/EPCAM
Clone Name SAA1341
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16451-1MG
Uniprot ID P16422
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Aliases /Synonyms anti-Epithelial glycoprotein 314, anti-hEGP314, anti-Major gastrointestinal tumor-associated protein GA733-2, anti-EGP314, anti-TACSTD1, anti-Adenocarcinoma-associated antigen, anti-TROP1, anti-EPCAM, anti-Epithelial glycoprotein, anti-KS 1/4 antigen, anti-Tumor-associated calcium signal transducer 1, anti-M4S1, anti-CD326, anti-Ep-CAM, anti-EGP, anti-Epithelial cell adhesion molecule, anti-M1S2, anti-KSA, anti-Cell surface glycoprotein Trop-1, anti-GA733-2, anti-Epithelial cell surface antigen, anti-MIC18
Reference ARO-A16451
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD326/EPCAM
Clone Name SAA1341
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16451-50
Uniprot ID P16422
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Human
Aliases /Synonyms anti-Epithelial glycoprotein 314, anti-hEGP314, anti-Major gastrointestinal tumor-associated protein GA733-2, anti-EGP314, anti-TACSTD1, anti-Adenocarcinoma-associated antigen, anti-TROP1, anti-EPCAM, anti-Epithelial glycoprotein, anti-KS 1/4 antigen, anti-Tumor-associated calcium signal transducer 1, anti-M4S1, anti-CD326, anti-Ep-CAM, anti-EGP, anti-Epithelial cell adhesion molecule, anti-M1S2, anti-KSA, anti-Cell surface glycoprotein Trop-1, anti-GA733-2, anti-Epithelial cell surface antigen, anti-MIC18
Reference ARO-A16451
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD326/EPCAM
Clone Name SAA1341
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human CD326/EPCAM VHH (SAA1341)

SDS-PAGE for Anti-Human CD326/EPCAM VHH (SAA1341)

Anti-Human CD326/EPCAM VHH (SAA1341), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human CD326/EPCAM VHH (SAA1341)

There are no reviews yet.

Be the first to review “Anti-Human CD326/EPCAM VHH (SAA1341)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products