Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human CCL3/MIP-1-alpha VHH (SAA1270)

Note:
For research use only. Not suitable for human use.

Original price was: €325.00.Current price is: €266.00.

50ug 18% OFF + 266 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human CCL3/MIP-1-alpha VHH (SAA1270)

Product name ARO-A16439-100
Uniprot ID P10147
Raw Antigen Sequence MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Tonsillar lymphocyte LD78 alpha protein, anti-CCL3, anti-G0S19-1, anti-MIP1A, anti-Macrophage inflammatory protein 1-alpha, anti-LD78-alpha(4-69), anti-SCYA3, anti-SIS-beta, anti-Small-inducible cytokine A3, anti-C-C motif chemokine 3, anti-G0/G1 switch regulatory protein 19-1, anti-PAT 464.1, anti-MIP-1-alpha
Reference ARO-A16439
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CCL3/MIP-1-alpha
Clone Name SAA1270
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16439-1MG
Uniprot ID P10147
Raw Antigen Sequence MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Tonsillar lymphocyte LD78 alpha protein, anti-CCL3, anti-G0S19-1, anti-MIP1A, anti-Macrophage inflammatory protein 1-alpha, anti-LD78-alpha(4-69), anti-SCYA3, anti-SIS-beta, anti-Small-inducible cytokine A3, anti-C-C motif chemokine 3, anti-G0/G1 switch regulatory protein 19-1, anti-PAT 464.1, anti-MIP-1-alpha
Reference ARO-A16439
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CCL3/MIP-1-alpha
Clone Name SAA1270
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16439-50
Uniprot ID P10147
Raw Antigen Sequence MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Tonsillar lymphocyte LD78 alpha protein, anti-CCL3, anti-G0S19-1, anti-MIP1A, anti-Macrophage inflammatory protein 1-alpha, anti-LD78-alpha(4-69), anti-SCYA3, anti-SIS-beta, anti-Small-inducible cytokine A3, anti-C-C motif chemokine 3, anti-G0/G1 switch regulatory protein 19-1, anti-PAT 464.1, anti-MIP-1-alpha
Reference ARO-A16439
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CCL3/MIP-1-alpha
Clone Name SAA1270
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human CCL3/MIP-1-alpha VHH (SAA1270)

SDS-PAGE for Anti-Human CCL3/MIP-1-alpha VHH (SAA1270)

Anti-Human CCL3/MIP-1-alpha VHH (SAA1270), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human CCL3/MIP-1-alpha VHH (SAA1270)

There are no reviews yet.

Be the first to review “Anti-Human CCL3/MIP-1-alpha VHH (SAA1270)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products