Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Annexin A2(ANXA2)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Annexin A2(ANXA2) |
|---|---|
| Uniprot ID | P07355 |
| Uniprot link | https://www.uniprot.org/uniprot/P07355 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIA FAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEIN RVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISI MTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVL IRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD* |
| Molecular weight | 38.61 kDa |
| Protein delivered with Tag? | N terminus His tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1-Asp339 |
| Protein Accession | P07355 |
| Spec:Entrez GeneID | 302 |
| Spec:NCBI Gene Aliases | P36; ANX2; LIP2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; HEL-S-270 |
| Spec:SwissProtID | Q9UDH8 |
| NCBI Reference | P07355 |
| Aliases /Synonyms | Annexin II，Annexin-2，Calpactin I heavy chain，Calpactin-1 heavy chain，Chromobindin-8，Lipocortin II，Placental anticoagulant protein IV，PAP-IV ，Protein I，p36，ANX2, ANX2L4, CAL1H, LPC2D |
| Reference | PX-P4794 |
| Note | For research use only |
Related products
Polyclonal Antibody
ANXA2 Polyclonal Polyclonal Antibody
PTX18470 169€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.