Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tulinercept Biosimilar – Anti-TNF fusion protein – Research Grade

  • PX-TA2023-50
  • Validated ELISA
Uniprot ID:
P01375

Original price was: €186.00.Current price is: €140.00.

50ug 25% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tulinercept Biosimilar - Anti-TNF fusion protein - Research Grade

Product name Tulinercept Biosimilar - Anti-TNF fusion protein - Research Grade
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2023
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1B (tumor necrosis factor receptor (TNFR) superfamily member 1B, TNFBR, p75, CD120b)]2 - IGHG1 Fc (Fragment constant)
Product name Tulinercept Biosimilar - Anti-TNF fusion protein - Research Grade
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2023
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1B (tumor necrosis factor receptor (TNFR) superfamily member 1B, TNFBR, p75, CD120b)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2023-50
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2023
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1B (tumor necrosis factor receptor (TNFR) superfamily member 1B, TNFBR, p75, CD120b)]2 - IGHG1 Fc (Fragment constant)

Tulinercept Biosimilar: A Promising Anti-TNF Fusion Protein for Therapeutic Targeting

Tulinercept Biosimilar is a novel biologic drug that has gained significant attention in the field of immunology and biotechnology. It is an anti-tumor necrosis factor (TNF) fusion protein that has shown promising results in pre-clinical studies for the treatment of various inflammatory and autoimmune diseases. In this article, we will discuss the structure, activity, and potential applications of Tulinercept Biosimilar in detail.

Structure of Tulinercept Biosimilar

Tulinercept Biosimilar is a recombinant fusion protein that consists of two components – a soluble TNF receptor (TNFR) and a human IgG1 Fc domain. The TNFR component is derived from the extracellular domain of human TNFR1, which is responsible for binding to TNF. The Fc domain, on the other hand, is responsible for extending the half-life of the drug and enhancing its stability. The two components are linked together by a flexible linker, resulting in a single molecule with a molecular weight of approximately 150 kDa.

The structure of Tulinercept Biosimilar is similar to that of the approved biologic drug, Etanercept, which is used for the treatment of various inflammatory diseases. However, Tulinercept Biosimilar has a higher binding affinity for TNF and a longer half-life, making it a potentially more effective and convenient treatment option.

Activity of Tulinercept Biosimilar

The primary mechanism of action of Tulinercept Biosimilar is to bind and neutralize TNF, a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of many autoimmune and inflammatory diseases. TNF is known to induce the production of other inflammatory cytokines, activate immune cells, and promote tissue damage, making it a prime therapeutic target for these conditions.

Tulinercept Biosimilar works by binding to TNF and preventing it from interacting with its receptors on immune cells. This leads to a decrease in the production of inflammatory cytokines and a reduction in immune cell activation, ultimately resulting in a decrease in disease symptoms and progression.

Potential Applications of Tulinercept Biosimilar

Tulinercept Biosimilar has shown promising results in pre-clinical studies for the treatment of various inflammatory and autoimmune diseases, including rheumatoid arthritis, psoriasis, Crohn’s disease, and ulcerative colitis. It has also been studied for its potential in treating other conditions such as ankylosing spondylitis, juvenile idiopathic arthritis, and psoriatic arthritis.

In addition to its potential as a therapeutic drug, Tulinercept Biosimilar also has potential applications in research and diagnostic settings. Its high binding affinity for TNF makes it a valuable tool for studying the role of TNF in various diseases and for developing diagnostic assays to measure TNF levels in patient samples.

Conclusion

Tulinercept Biosimilar is a promising anti-TNF fusion protein with a unique structure and mechanism of action. It has the potential to be a more effective and convenient treatment option for various inflammatory and autoimmune diseases, and its applications in research and diagnostics make it a versatile and valuable drug. Further clinical studies are needed to fully understand its safety and efficacy, but the early results are promising, and Tulinercept Biosimilar has the potential to make a significant impact in the field of immunology and biotechnology.

Research Grade Tulinercept in ELISA Assay

Research Grade Tulinercept in ELISA Assay

Research Grade Tulinercept can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Tulinercept

SDS-PAGE for Research Grade Tulinercept

Research Grade Tulinercept, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tulinercept Biosimilar - Anti-TNF fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Tulinercept Biosimilar – Anti-TNF fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products