Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Staphylococcus GlmR3 Recombinant Protein |
|---|---|
| Uniprot ID | Q99V41 |
| Uniprot link | http://www.uniprot.org/uniprot/Q99V41 |
| Origin species | Staphylococcus |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLAYTVTKPQTTQTVSKIAQVKPNNTGIRASVYEKTAKNGAKYADRTFYVTKERAHGNETYVLLNNTSHNIPLGWFNVKDLNVQNLGKEVKTTQKYTVNKSNNGLSMVPWGTKNQVILTGNNIAQGTFNATKQVSVGKDVYLYGTINNRTGWVNAKDLTAPTAVKPTTSAAKDYNYTYVIK |
| Molecular weight | 21.14 kDa |
| Purity estimated | 85% |
| Buffer | PBS, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | WP_031826599.1 |
| Spec:Entrez GeneID | 1123728 |
| Spec:SwissProtID | Q99V41 |
| NCBI Reference | WP_031826599.1 |
| Aliases /Synonyms | GlmR3, Bifunctional autolysin, atl, nag, SA0905 |
| Reference | PX-P2073 |
| Note | For research use only |
Bifunctional autolysin from Staphylococcus aureus has multiple roles; it hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in certain cell-wall glycopeptides. It acts as endohydrolysis of the N,N’-diacetylchitobiosyl unit in high-mannose glycopeptides and glycoproteins containing the -(Man(GlcNAc)2)Asn-structure. It cleaves the peptidoglycan connecting the daughter cells at the end of the cell division cycle, resulting in the separation of the two newly divided cells. Acts as an autolysin in penicillin-induced lysis.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.