Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SUMF1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8NBK3
Molecular weight:
30.00 kDa

Original price was: €222.00.Current price is: €193.00.

50ug 13% OFF + 193 loyalty points
Glu113–Ser356
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SUMF1, N-His

Product name ARO-P13242-100
Uniprot ID Q8NBK3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDS
Molecular weight 30.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu113-Ser356
Aliases /Synonyms Formylglycine-generating enzyme, FGE, SUMF1, Sulfatase-modifying factor 1, C-alpha-formylglycine-generating enzyme 1
Reference ARO-P13242
Note For research use only.
Molecular Constructor
Glu113–Ser356
Product name ARO-P13242-1MG
Uniprot ID Q8NBK3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDS
Molecular weight 30.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu113-Ser356
Aliases /Synonyms Formylglycine-generating enzyme, FGE, SUMF1, Sulfatase-modifying factor 1, C-alpha-formylglycine-generating enzyme 1
Reference ARO-P13242
Note For research use only.
Molecular Constructor
Glu113–Ser356
Product name ARO-P13242-50
Uniprot ID Q8NBK3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDS
Molecular weight 30.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu113-Ser356
Aliases /Synonyms Formylglycine-generating enzyme, FGE, SUMF1, Sulfatase-modifying factor 1, C-alpha-formylglycine-generating enzyme 1
Reference ARO-P13242
Note For research use only.
Molecular Constructor
Glu113–Ser356

Introduction

Recombinant Human SUMF1 is a highly specialized protein that plays a crucial role in various biological processes. This protein is produced through recombinant DNA technology, making it a valuable tool for researchers in the field of biotechnology and medicine. In this article, we will discuss the structure, activity, and applications of Recombinant Human SUMF1.

Structure of Recombinant Human SUMF1

Recombinant Human SUMF1 is a 352 amino acid protein with a molecular weight of approximately 40 kDa. It is composed of a signal peptide, a propeptide, and a mature peptide. The mature peptide contains the active site of the protein and is responsible for its biological activity.

The crystal structure of Recombinant Human SUMF1 has been determined through X-ray crystallography, revealing a compact globular structure with a central beta-sheet surrounded by alpha-helices. The active site of the protein is located in a deep cleft between two alpha-helices, making it easily accessible for substrate binding.

Activity of Recombinant Human SUMF1

The primary function of Recombinant Human SUMF1 is the post-translational modification of various sulfatases, which are enzymes involved in the breakdown of complex sugars. This modification, known as sulfation, is essential for the proper functioning of sulfatases.

Recombinant Human SUMF1 catalyzes the transfer of a sulfate group from the donor molecule 3′-phosphoadenosine-5′-phosphosulfate (PAPS) to the target sulfatase, resulting in the formation of an active enzyme. This process is crucial for the degradation of sulfated compounds, such as glycosaminoglycans, which are essential components of connective tissues, cartilage, and bone.

In addition to its role in sulfatase activation, Recombinant Human SUMF1 has also been found to have neuroprotective properties. It has been shown to protect neurons from oxidative stress and promote cell survival in various neurodegenerative diseases, such as Parkinson’s and Alzheimer’s.

Applications of Recombinant Human SUMF1

Recombinant Human SUMF1 has a wide range of applications in both research and medicine. Its ability to activate sulfatases makes it a valuable tool for studying various biological processes involving sulfated compounds. It is commonly used in studies related to connective tissue disorders, lysosomal storage diseases, and neurodegenerative diseases.

In the field of medicine, Recombinant Human SUMF1 has shown promising results in the treatment of lysosomal storage diseases, such as mucopolysaccharidoses (MPS). These diseases are caused by the deficiency of specific sulfatases, and the administration of Recombinant Human SUMF1 has been shown to improve the activity of these enzymes and alleviate symptoms in patients.

Furthermore, the neuroprotective properties of Recombinant Human SUMF1 make it a potential therapeutic agent for neurodegenerative diseases. Clinical trials are currently underway to evaluate its effectiveness in the treatment of Parkinson’s and Alzheimer’s diseases.

Conclusion

In summary, Recombinant Human SUMF1 is a crucial protein with diverse functions in various biological processes. Its structure and activity have been extensively studied, and its applications in research and medicine are continuously expanding. With its potential therapeutic benefits, Recombinant Human SUMF1 holds great promise for the treatment of various diseases and offers exciting opportunities for further research and development.

Keywords: Recombinant Human SUMF1, recombinant protein, antigen, sulfatase, sulfation, neuroprotection, lysosomal storage diseases, mucopolysaccharidoses, Parkinson’s disease, Alzheimer’s disease.

Recombinant Human SUMF1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SUMF1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products