Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NPC2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P61916
Molecular weight:
15.68 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Asp31–Leu151
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NPC2 Protein, N-His

Product name ARO-P11995-100
Uniprot ID P61916
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Molecular weight 15.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp31-Leu151
Aliases /Synonyms HE1, NPC intracellular cholesterol transporter 2, He1, Epididymal secretory protein E1, Human epididymis-specific protein 1, NPC2, Niemann-Pick disease type C2 protein
Reference ARO-P11995
Note For research use only.
Molecular Constructor
Asp31–Leu151
Product name ARO-P11995-1MG
Uniprot ID P61916
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Molecular weight 15.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp31-Leu151
Aliases /Synonyms HE1, NPC intracellular cholesterol transporter 2, He1, Epididymal secretory protein E1, Human epididymis-specific protein 1, NPC2, Niemann-Pick disease type C2 protein
Reference ARO-P11995
Note For research use only.
Molecular Constructor
Asp31–Leu151
Product name ARO-P11995-50
Uniprot ID P61916
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
Molecular weight 15.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp31-Leu151
Aliases /Synonyms HE1, NPC intracellular cholesterol transporter 2, He1, Epididymal secretory protein E1, Human epididymis-specific protein 1, NPC2, Niemann-Pick disease type C2 protein
Reference ARO-P11995
Note For research use only.
Molecular Constructor
Asp31–Leu151

Introduction

Recombinant Human NPC2 Protein, also known as Niemann-Pick disease type C2 protein, is a small glycoprotein that plays a crucial role in the transport of cholesterol and other lipids within cells. This protein is encoded by the NPC2 gene and is highly conserved among different species, indicating its importance in cellular function. In this article, we will discuss the structure, activity, and application of Recombinant Human NPC2 Protein.

Structure of Recombinant Human NPC2 Protein

Recombinant Human NPC2 Protein is composed of 151 amino acids and has a molecular weight of approximately 17 kDa. It has a unique three-dimensional structure, consisting of eight alpha-helices and two beta-sheets, which form a beta-barrel shape. This structure is essential for the protein’s function in binding and transporting cholesterol and other lipids.

Activity of Recombinant Human NPC2 Protein

Recombinant Human NPC2 Protein is primarily involved in the intracellular transport of cholesterol and other lipids. It binds to cholesterol and other lipids in the lysosomes, which are cellular organelles responsible for breaking down and recycling cellular waste. The protein then transports these molecules to the cell membrane, where they can be utilized for various cellular processes.

In addition to its role in lipid transport, Recombinant Human NPC2 Protein also plays a crucial role in the regulation of cellular cholesterol levels. It interacts with other proteins, such as NPC1 and NPC2L1, to maintain the balance of cholesterol within cells. This is particularly important in cells that are involved in cholesterol metabolism, such as liver and brain cells.

Application of Recombinant Human NPC2 Protein

Recombinant Human NPC2 Protein has various applications in both research and medicine. Its ability to bind and transport cholesterol and other lipids makes it a valuable tool in studying lipid metabolism and related diseases. For example, researchers can use this protein to study the mechanisms of cholesterol transport and its role in diseases such as atherosclerosis and Niemann-Pick disease type C.

In medicine, Recombinant Human NPC2 Protein has shown potential as a therapeutic agent for Niemann-Pick disease type C. This rare genetic disorder is characterized by the accumulation of cholesterol and other lipids in the lysosomes, leading to various neurological and developmental problems. Studies have shown that administering Recombinant Human NPC2 Protein can reduce the accumulation of lipids in cells and improve symptoms in patients with this disease.

Furthermore, Recombinant Human NPC2 Protein has also been studied for its potential in treating other disorders related to cholesterol metabolism, such as hypercholesterolemia and non-alcoholic fatty liver disease. Its ability to regulate cellular cholesterol levels makes it a promising candidate for developing new treatments for these conditions.

Conclusion

Recombinant Human NPC2 Protein is a small but crucial protein involved in the transport and regulation of cholesterol and other lipids within cells. Its unique structure and activity make it a valuable tool in research and a potential therapeutic agent for various diseases. Further studies on this protein may lead to new insights into lipid metabolism and the development of novel treatments for related disorders.

Recombinant Human NPC2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NPC2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products