Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DNAAF4 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WXU2
Molecular weight:
37.20 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Pro2–Ala80
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DNAAF4 Protein, N-GST & C-His

Product name ARO-P12186-100
Uniprot ID Q8WXU2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PLQVSDYSWQQTKTAVFLSLPLKGVCVRDTDVFCTENYLKVNFPPFLFEAFLYAPIDDESSKAKIGNDTIVFTLYKKEA
Molecular weight 37.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Ala80
Aliases /Synonyms DYX1C1, EKN1, Dynein assembly factor 4, axonemal, DNAAF4, Dyslexia susceptibility 1 candidate gene 1 protein
Reference ARO-P12186
Note For research use only.
Molecular Constructor
Pro2–Ala80
Product name ARO-P12186-1MG
Uniprot ID Q8WXU2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PLQVSDYSWQQTKTAVFLSLPLKGVCVRDTDVFCTENYLKVNFPPFLFEAFLYAPIDDESSKAKIGNDTIVFTLYKKEA
Molecular weight 37.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Ala80
Aliases /Synonyms DYX1C1, EKN1, Dynein assembly factor 4, axonemal, DNAAF4, Dyslexia susceptibility 1 candidate gene 1 protein
Reference ARO-P12186
Note For research use only.
Molecular Constructor
Pro2–Ala80
Product name ARO-P12186-50
Uniprot ID Q8WXU2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PLQVSDYSWQQTKTAVFLSLPLKGVCVRDTDVFCTENYLKVNFPPFLFEAFLYAPIDDESSKAKIGNDTIVFTLYKKEA
Molecular weight 37.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro2-Ala80
Aliases /Synonyms DYX1C1, EKN1, Dynein assembly factor 4, axonemal, DNAAF4, Dyslexia susceptibility 1 candidate gene 1 protein
Reference ARO-P12186
Note For research use only.
Molecular Constructor
Pro2–Ala80

Introduction

Recombinant Human DNAAF4 Protein, also known as DNAI1-Associated Protein 1 (DNAAF4), is a protein encoded by the DNAAF4 gene. This protein is involved in the function of cilia, which are hair-like structures found on the surface of cells. Cilia play important roles in various biological processes, including cell signaling, movement, and sensing. Mutations in the DNAAF4 gene have been linked to several ciliopathies, which are disorders caused by defects in cilia function. In this article, we will discuss the structure, activity, and applications of Recombinant Human DNAAF4 Protein.

Structure of Recombinant Human DNAAF4 Protein

Recombinant Human DNAAF4 Protein is a 48 kDa protein consisting of 430 amino acids. It belongs to the DNAAF family of proteins, which also includes DNAI1 and DNAI2. The protein contains several functional domains, including a coiled-coil domain, a leucine zipper motif, and a conserved domain known as the DUF1398 domain. The DUF1398 domain is found in all members of the DNAAF family and is thought to be involved in protein-protein interactions.

Activity of Recombinant Human DNAAF4 Protein

Recombinant Human DNAAF4 Protein is involved in the function of cilia by interacting with other proteins in the ciliary axoneme, which is the core structure of cilia. It has been shown to interact with DNAI1, a protein involved in the movement of cilia. This interaction is important for the proper assembly and function of cilia. In addition, Recombinant Human DNAAF4 Protein has been shown to play a role in the regulation of ciliary length. This is important for the proper functioning of cilia, as defects in ciliary length have been linked to ciliopathies.

Applications of Recombinant Human DNAAF4 Protein

Recombinant Human DNAAF4 Protein has several potential applications in both research and medicine. One potential application is in the study of ciliopathies. Mutations in the DNAAF4 gene have been linked to several ciliopathies, including primary ciliary dyskinesia, a disorder characterized by defects in cilia movement. By studying the structure and function of Recombinant Human DNAAF4 Protein, researchers can gain a better understanding of the underlying mechanisms of these disorders.

In addition, Recombinant Human DNAAF4 Protein can also be used as an antigen in the development of diagnostic tests for ciliopathies. Antibodies against this protein can be used to detect the presence of mutations in the DNAAF4 gene, which can aid in the diagnosis of these disorders.

Furthermore, Recombinant Human DNAAF4 Protein can also be used in the development of potential therapeutics for ciliopathies. By understanding the role of this protein in cilia function, researchers can potentially develop targeted treatments for these disorders.

Conclusion

Recombinant Human DNAAF4 Protein is an important protein involved in the function of cilia. Its structure, activity, and potential applications make it a valuable tool for the study of ciliopathies. Further research on this protein can lead to a better understanding of cilia function and potential treatments for ciliopathies.

Recombinant Human DNAAF4 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human DNAAF4 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products