Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant HPV18 E6/Protein E6 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human papillomavirus type 18
Uniprot ID:
P06463
Molecular weight:
21.02 kDa

Original price was: €283.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
Met1–Val158
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant HPV18 E6/Protein E6 Protein, N-His

Product name ARO-P11543-100
Uniprot ID P06463
Origin species Human papillomavirus type 18
Expression system Prokaryotic expression
Raw Antigen Sequence MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV
Molecular weight 21.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val158
Aliases /Synonyms Protein E6, E6
Reference ARO-P11543
Note For research use only.
Molecular Constructor
Met1–Val158
Product name ARO-P11543-1MG
Uniprot ID P06463
Origin species Human papillomavirus type 18
Expression system Prokaryotic expression
Raw Antigen Sequence MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV
Molecular weight 21.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val158
Aliases /Synonyms Protein E6, E6
Reference ARO-P11543
Note For research use only.
Molecular Constructor
Met1–Val158
Product name ARO-P11543-50
Uniprot ID P06463
Origin species Human papillomavirus type 18
Expression system Prokaryotic expression
Raw Antigen Sequence MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEVFEFAFKDLFVVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLLIRCLRCQKPLNPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV
Molecular weight 21.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val158
Aliases /Synonyms Protein E6, E6
Reference ARO-P11543
Note For research use only.
Molecular Constructor
Met1–Val158

Introduction to Recombinant HPV18 E6/Protein E6 Protein

Recombinant HPV18 E6/Protein E6 Protein is a genetically engineered protein that is derived from the human papillomavirus type 18 (HPV18) E6 protein. This protein plays a crucial role in the pathogenesis of cervical cancer, making it an important target for research and development of potential treatments. In this article, we will discuss the structure, activity, and application of Recombinant HPV18 E6/Protein E6 Protein.

Structure of Recombinant HPV18 E6/Protein E6 Protein

Recombinant HPV18 E6/Protein E6 Protein is a 158-amino acid protein that is produced through genetic engineering techniques. It is a recombinant protein, meaning it is created by combining genetic material from different sources. In this case, the genetic material from HPV18 E6 protein is inserted into a host organism, such as bacteria or yeast, to produce large quantities of the protein.

The structure of Recombinant HPV18 E6/Protein E6 Protein is similar to that of the natural HPV18 E6 protein. It is composed of two zinc-binding domains, which are essential for its biological activity. These domains are responsible for the interaction of the protein with its target molecules, making it a crucial component of HPV18-related diseases.

Activity of Recombinant HPV18 E6/Protein E6 Protein

Recombinant HPV18 E6/Protein E6 Protein is a potent oncoprotein, meaning it has the ability to cause cancer. It does so by targeting and degrading a tumor suppressor protein called p53, which is responsible for regulating cell growth and preventing the formation of tumors. By degrading p53, Recombinant HPV18 E6/Protein E6 Protein allows for uncontrolled cell growth, leading to the development of cervical cancer.

In addition to its role in cancer development, Recombinant HPV18 E6/Protein E6 Protein has also been found to play a role in immune evasion. It can suppress the immune response by inhibiting the production of interferons, which are important signaling molecules that activate the immune system. This activity allows the virus to evade detection and continue to replicate, leading to persistent infection and potentially, the development of cancer.

Application of Recombinant HPV18 E6/Protein E6 Protein

Recombinant HPV18 E6/Protein E6 Protein has been extensively studied for its potential as a therapeutic target for HPV-related diseases, particularly cervical cancer. It has been used in various research studies to understand its role in cancer development and to develop potential treatments. One such treatment approach is the use of therapeutic vaccines that target Recombinant HPV18 E6/Protein E6 Protein.

Therapeutic vaccines work by stimulating the immune system to recognize and attack cancer cells. In the case of HPV-related cancers, the vaccine would target Recombinant HPV18 E6/Protein E6 Protein, which is overexpressed in these cancers. By targeting the oncoprotein, the vaccine would prevent its activity and potentially lead to the regression of the cancer.

In addition to its potential as a therapeutic target, Recombinant HPV18 E6/Protein E6 Protein is also used in diagnostic tests for HPV infection. These tests detect the presence of the protein in samples from cervical cells, allowing for early detection and treatment of HPV-related diseases.

Conclusion

In conclusion, Recombinant HPV18 E6/Protein E6 Protein is a genetically engineered protein that plays a crucial role in the development of HPV-related diseases, particularly cervical cancer. Its structure, activity, and potential applications make it an important target for research and development of potential treatments. Further studies on this protein may lead to the development of more effective therapies for HPV-related diseases and ultimately, improve patient outcomes.

Recombinant HPV18 E6/Protein E6 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant HPV18 E6/Protein E6 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products