Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Plasmodium falciparum PF10Nter Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product namePlasmodium falciparum PF10Nter Recombinant Protein
Uniprot IDQ8IK14
Uniprot linkhttp://www.uniprot.org/uniprot/Q8IK14
Origin speciesPlasmodium falciparum
Expression systemProkaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMQINPMEKS SFVQTRIFPPKPTIFSLEKNDDFLNTHNEGFLILSYCFAISLFMYIVLKNLYYLYIFKRTRIKIIESLNNDNNVENEIEE MKRVKNLIMEQVIHELMRKSIISKRRTRKDIETDLSQNVRNEDMNLKENEIEMTQVETLKHLIHNNLLTEFHDTKEKNLE SFIKFLQQLMTLEKNEKEFSNNILVKDLMDYIINIGKKEIQKSNTQLSQASSQNYIPSNENDIYIFQIQVIKELLKNNII ITHSNDGKQLDDEIITKILEESLMSQANVVEYFYIEMIKNILGNDYNELNAISYTHDDLYLQKYEKELIKKKLSQYAYKN MNTKQNNKYVQDKTVNKHIHKNQIEQNEATTNLIEKENTFEKTNKFDNNGMIQNNIPIQAETNDESMKNIIQHKELLKNH DKENKNEEIENMNQHKKEECNYNDKKAVTEHSKKSRKNFKRKCMKKRDIRHLYQIDKLQDKILKNLMGQDSIESDSKNND IQQLEEQKSDIQNEKLATSNEQEETRNTNNEHKENEVNMDQNNMKLNIYNLNNQDIQNHYDKNVKEKLEEENILSDNIIK HHHHHH
Molecular weight95,44 kDa
Purity estimated80%
BufferTrisHC 50mMl, 10mM reduced glutathion pH8
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionXP_001347311.1*
Spec:Entrez GeneID810184
Spec:SwissProtIDQ8IK14
NCBI ReferenceXP_001347311.1*
Aliases /SynonymsPF10Nter , Tryptophan-rich antigen 3, putative, PF10_0026, PF3D7_1002200
ReferencePX-P1139
NoteFor research use only

Description of Plasmodium falciparum PF10Nter Recombinant Protein

General information on Plasmodium falciparum PF10Nter Recombinant Protein

Tryptophan-rich protein expressed in the late stage schizonts and merozoite stages and because of its association with the surface of merozoites. The protein is localized on the surface of merozoites. The characteristic of the protein is similar to a P. yoelii antigen, pypAg-3, which have been successfully used in vaccination studies in mice. The conservation and uniqueness of the tryptophan-rich domains in plasmodial species, is anindication that it may be an important and essential feature of parasite function.

Publication

  • 1: Ntumngia FB, Bouyou-Akotet MK, Uhlemann AC, Mordmüller B, Kremsner PG, Kun JF._x000D_ Characterisation of a tryptophan-rich Plasmodium falciparum antigen associated_x000D_ with merozoites. Mol Biochem Parasitol. 2004 Oct;137(2):349-53. PubMed PMID:_x000D_ 15383306.
  • _x000D_ _x000D_ _x000D_
  • 2: LaCount DJ, Vignali M, Chettier R, Phansalkar A, Bell R, Hesselberth JR,_x000D_ Schoenfeld LW, Ota I, Sahasrabudhe S, Kurschner C, Fields S, Hughes RE. A protein_x000D_ interaction network of the malaria parasite Plasmodium falciparum. Nature. 2005_x000D_ Nov 3;438(7064):103-7. PubMed PMID: 16267556.
  • _x000D_ _x000D_ _x000D_
  • 3: Gardner MJ, Hall N, Fung E, White O, Berriman M, Hyman RW, Carlton JM, Pain A,_x000D_ Nelson KE, Bowman S, Paulsen IT, James K, Eisen JA, Rutherford K, Salzberg SL,_x000D_ Craig A, Kyes S, Chan MS, Nene V, Shallom SJ, Suh B, Peterson J, Angiuoli S,_x000D_ Pertea M, Allen J, Selengut J, Haft D, Mather MW, Vaidya AB, Martin DM, Fairlamb _x000D_ AH, Fraunholz MJ, Roos DS, Ralph SA, McFadden GI, Cummings LM, Subramanian GM,_x000D_ Mungall C, Venter JC, Carucci DJ, Hoffman SL, Newbold C, Davis RW, Fraser CM,_x000D_ Barrell B. Genome sequence of the human malaria parasite Plasmodium falciparum._x000D_ Nature. 2002 Oct 3;419(6906):498-511. PubMed PMID: 12368864; PubMed Central_x000D_ PMCID: PMC3836256.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Plasmodium falciparum PF10Nter Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Plasmodium falciparum PF10Nter Recombinant Protein
Receptor

Plasmodium falciparum PF10Nter Recombinant Protein

PX-P1139 210€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products