Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Galsulfase Biosimilar – G4S – Research Grade

Uniprot ID:
P15848

Original price was: €178.00.Current price is: €140.00.

50ug 21% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Galsulfase Biosimilar - G4S - Research Grade

Product name Galsulfase Biosimilar - G4S - Research Grade
Uniprot ID P15848
Expression system XtenCHO
Raw Antigen Sequence MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-G4S,ASB,N-acetylgalactosamine-4-sulfatase,ARSB,Arylsulfatase B,
Reference PX-TA1909
Note For research use only. Not suitable for clinical or therapeutic use.
Product name Galsulfase Biosimilar - G4S - Research Grade
Uniprot ID P15848
Expression system XtenCHO
Raw Antigen Sequence MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-G4S,ASB,N-acetylgalactosamine-4-sulfatase,ARSB,Arylsulfatase B,
Reference PX-TA1909
Note For research use only. Not suitable for clinical or therapeutic use.
Product name PX-TA1909-50
Uniprot ID P15848
Expression system XtenCHO
Raw Antigen Sequence MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-G4S,ASB,N-acetylgalactosamine-4-sulfatase,ARSB,Arylsulfatase B,
Reference PX-TA1909
Note For research use only. Not suitable for clinical or therapeutic use.

The Structure of Galsulfase Biosimilar – G4S – Research Grade

Galsulfase Biosimilar – G4S – Research Grade, also known as galsulfase, is a recombinant form of the human enzyme N-acetylgalactosamine 4-sulfatase (GALNS). It is produced through genetic engineering technology and has a similar structure to the naturally occurring enzyme found in humans.

The protein structure of G4S is made up of 532 amino acids and has a molecular weight of approximately 60 kDa. It contains two carbohydrate chains, which are essential for its biological activity. These chains are responsible for targeting the enzyme to the lysosomes, where it can carry out its therapeutic function.

The Activity of Galsulfase Biosimilar – G4S – Research Grade

Galsulfase Biosimilar – G4S – Research Grade is a therapeutic protein that is used to treat patients with mucopolysaccharidosis type VI (MPS VI), also known as Maroteaux-Lamy syndrome. This rare genetic disorder is caused by a deficiency in the GALNS enzyme, which is responsible for breaking down complex sugars in the body.

G4S works by replacing the missing or deficient GALNS enzyme, allowing for the breakdown of complex sugars and preventing their accumulation in the body. This helps to improve the symptoms of MPS VI, such as skeletal abnormalities, respiratory problems, and heart disease.

The Application of Galsulfase Biosimilar – G4S – Research Grade

Galsulfase Biosimilar – G4S – Research Grade is currently approved for use in the treatment of MPS VI in both children and adults. It is administered through intravenous infusion and is typically given once a week.

In addition to its approved use, G4S is also being studied for its potential in treating other lysosomal storage disorders, such as mucolipidosis II and III. These disorders also involve a deficiency in the GALNS enzyme, making G4S a potential treatment option.

Furthermore, G4S is also being investigated for its potential in combination with other therapies, such as gene therapy, to further improve the treatment outcomes for patients with MPS VI.

The Role of Antibodies in Galsulfase Biosimilar – G4S – Research Grade Antibodies play a crucial role in the development and production of Galsulfase Biosimilar – G4S – Research Grade. During the manufacturing process, specific antibodies are used to identify and isolate the recombinant GALNS enzyme, ensuring its purity and potency.

In addition, antibodies are also used in the quality control process to ensure that the final product meets the required specifications for safety and efficacy.

The Therapeutic Target of Galsulfase Biosimilar – G4S – Research Grade

The therapeutic target of Galsulfase Biosimilar – G4S – Research Grade is the GALNS enzyme. By targeting this enzyme, G4S aims to restore its activity and function in patients with MPS VI, thereby improving their symptoms and overall quality of life.

The GALNS enzyme is located in the lysosomes, which are specialized compartments within cells that are responsible for breaking down complex molecules. By targeting this specific location, G4S is able to deliver the enzyme directly to where it is needed, maximizing its therapeutic effect.

In Conclusion

Galsulfase Biosimilar – G4S – Research Grade is a recombinant form of the human enzyme GALNS and is used to treat patients with MPS VI. Its unique structure and activity allow it to effectively replace the missing or deficient enzyme in these patients, improving their symptoms and quality of life. With ongoing research and development, G4S may also have potential applications in other lysosomal storage disorders, making it a promising therapeutic option for a range of rare genetic diseases.

SDS-PAGE for Naglazyme;Galsulfase Biosimilar - Anti-ARSB mAb - Research Grade

SDS-PAGE for Naglazyme;Galsulfase Biosimilar - Anti-ARSB mAb - Research Grade

Naglazyme;Galsulfase Biosimilar - Anti-ARSB mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Galsulfase Biosimilar - G4S - Research Grade

There are no reviews yet.

Be the first to review “Galsulfase Biosimilar – G4S – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products