Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Latikafusp Biosimilar – Anti-PDCD1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1 Lambda - Il21 fragment

Original price was: €178.00.Current price is: €140.00.

50ug 21% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade

Product name Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade
Uniprot ID Q9HBE5 & Q15116
Species Homo Sapiens Fusion
Expression system XtenCHO
Raw Antigen Sequence MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Latikafusp,,PDCD1,anti-PDCD1
Reference PX-TA1856
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda - Il21 fragment
Clonality Monoclonal Antibody
Product name Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade
Uniprot ID Q9HBE5 & Q15116
Species Homo Sapiens Fusion
Expression system XtenCHO
Raw Antigen Sequence MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Latikafusp,,PDCD1,anti-PDCD1
Reference PX-TA1856
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda - Il21 fragment
Clonality Monoclonal Antibody
Product name PX-TA1856-50
Uniprot ID Q9HBE5 & Q15116
Species Homo Sapiens Fusion
Expression system XtenCHO
Raw Antigen Sequence MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Latikafusp,,PDCD1,anti-PDCD1
Reference PX-TA1856
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda - Il21 fragment
Clonality Monoclonal Antibody

Introduction

Latikafusp Biosimilar, also known as Anti-PDCD1 mAb – Research Grade, is a novel therapeutic antibody targeting the programmed cell death protein 1 (PDCD1) pathway. This biosimilar is designed to mimic the function of the original Latikafusp antibody, which has shown promising results in clinical trials for the treatment of various cancers. In this article, we will discuss the structure, activity, and potential applications of Latikafusp Biosimilar in the field of cancer therapy.

Structure of Latikafusp Biosimilar

Latikafusp Biosimilar is a monoclonal antibody (mAb) that specifically binds to the PDCD1 receptor on the surface of immune cells. It is a chimeric antibody, meaning it is composed of both human and mouse components. The variable region of the antibody is derived from a mouse antibody, while the constant region is humanized to minimize potential immune reactions in patients. This structure allows for high specificity and affinity towards the PDCD1 receptor, making it a highly effective therapeutic agent.

Activity of Latikafusp Biosimilar

The PDCD1 pathway plays a crucial role in regulating the immune response to cancer cells. PDCD1, also known as PD-1, is a receptor expressed on the surface of T cells, B cells, and natural killer cells. When activated by its ligands, PD-L1 or PD-L2, PDCD1 inhibits the function of these immune cells, allowing cancer cells to evade detection and destruction by the immune system. Latikafusp Biosimilar works by blocking the interaction between PDCD1 and its ligands, thus restoring the anti-tumor activity of immune cells.

Potential Applications of Latikafusp Biosimilar

The potential applications of Latikafusp Biosimilar are vast, as the PDCD1 pathway is involved in the development and progression of various types of cancer. Clinical trials have shown promising results in the treatment of melanoma, non-small cell lung cancer, and renal cell carcinoma. Furthermore, preclinical studies have also demonstrated the potential of Latikafusp Biosimilar in combination with other cancer therapies, such as chemotherapy and radiation, to enhance their efficacy.

Mechanism of Action

The mechanism of action of Latikafusp Biosimilar involves blocking the interaction between PDCD1 and its ligands, PD-L1 and PD-L2. This prevents the inhibitory signal from being transmitted to immune cells, allowing them to recognize and attack cancer cells. Additionally, the binding of Latikafusp Biosimilar to PDCD1 may also trigger an immune response, further enhancing the anti-tumor activity of immune cells.

Advantages of Latikafusp Biosimilar

Compared to the original Latikafusp antibody, the biosimilar version offers several advantages. Firstly, it is more cost-effective, making it more accessible to patients. Secondly, the humanized constant region reduces the risk of immune reactions, making it a safer option for patients. Lastly, the biosimilar can be produced in larger quantities, ensuring a stable and reliable supply for clinical use.

Conclusion

In conclusion, Latikafusp Biosimilar is a promising therapeutic agent in the field of cancer therapy. Its specific targeting of the PDCD1 pathway and potential applications in various types of cancer make it a valuable addition to the current arsenal of cancer treatments. With ongoing clinical trials and further research, Latikafusp Biosimilar has the potential to improve patient outcomes and contribute to the fight against cancer.

SDS-PAGE for Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade

SDS-PAGE for Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade

Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Latikafusp Biosimilar - Anti-PDCD1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Latikafusp Biosimilar – Anti-PDCD1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products