Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Human UHRF1(290-660) Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameHuman UHRF1(290-660) Recombinant Protein
Uniprot IDQ96T88
Uniprot linkhttp://www.uniprot.org/uniprot/Q96T88
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMAHNHRHKHKLVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEW YCPECRNDASEVVLAGERLRESKKNAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSE SGVHRPHVAGIHGRSNDGSYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPIND QEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRI KKLGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAG
Molecular weight42,63 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferNaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAF28469.1
Spec:Entrez GeneID29128
Spec:NCBI Gene AliaseshUHRF1, ICBP90, RNF106, Np95, huNp95, hNP95
Spec:SwissProtIDQ96T88
NCBI ReferenceAAF28469.1
Aliases /SynonymsICBP(290-660), transcription factor ICBP90
ReferencePX-P1063
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human UHRF1(290-660) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products