Skip to main content
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Human COL11A Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameHuman COL11A Recombinant Protein
Uniprot IDP12107
Uniprot linkhttp://www.uniprot.org/uniprot/P12107
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPR GSTAIGMKETAAAKFERQHMDSPDLGTGGGSGDDDDKSPMGYRGSEFSSAPKAAQAQEPQIDEANIVDDFQEYNYGTMES YQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSP PNEEFGPGVPAETDITETSINGHGAY
Molecular weight48,19 kDa
Protein delivered with Tag?Yes
Purity estimated>95%
BufferTrisHCl 50mM. PBS if dialysis
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAF04724.1
Spec:Entrez GeneID1301
Spec:NCBI Gene AliasesCOLL6, CO11A1, STL2
Spec:SwissProtIDP12107
NCBI ReferenceAAF04724.1
Aliases /SynonymsCO11A1, COBA1, COL11A1, COLL6, Collagen alpha-1(XI) chain, collagen XI, alpha-1 polypeptide, collagen, type XI, alpha 1, STL2
ReferencePX-P1081
NoteFor research use only

Publication

  • 1: Chen S, Zhou K, Yang L, Ding G, Li H. Racial Differences in Esophageal Squamous Cell Carcinoma: Incidence and Molecular Features. Biomed Res Int. 2017;2017:1204082. doi: 10.1155/2017/1204082. Epub 2017 Mar 14. PubMed PMID: 28393072; PubMed Central PMCID: PMC5368356.
  • 2: Li A, Li J, Lin J, Zhuo W, Si J. COL11A1 is overexpressed in gastric cancer tissues and regulates proliferation, migration and invasion of HGC-27 gastric cancer cells in vitro. Oncol Rep. 2017 Jan;37(1):333-340. doi: 10.3892/or.2016.5276. Epub 2016 Nov 25. PubMed PMID: 28004111.
  • 3: Wang J, Zhang C, Wu SG, Shang C, Huang L, Zhang T, Zhang W, Zhang Y, Zhang L. Additional Evidence Supports Association of Common Variants in COL11A1 with Increased Risk of Hip Osteoarthritis Susceptibility. Genet Test Mol Biomarkers. 2017 Feb;21(2):86-91. doi: 10.1089/gtmb.2016.0308. Epub 2016 Dec 12. PubMed PMID: 27936936.
  • 4: Shen L, Yang M, Lin Q, Zhang Z, Zhu B, Miao C. COL11A1 is overexpressed in recurrent non-small cell lung cancer and promotes cell proliferation, migration, invasion and drug resistance. Oncol Rep. 2016 Aug;36(2):877-85. doi: 10.3892/or.2016.4869. Epub 2016 Jun 10. PubMed PMID: 27373316.
  • 5: Zhang D, Zhu H, Harpaz N. Overexpression of α1 chain of type XI collagen (COL11A1) aids in the diagnosis of invasive carcinoma in endoscopically removed malignant colorectal polyps. Pathol Res Pract. 2016 Jun;212(6):545-8. doi: 10.1016/j.prp.2016.03.005. Epub 2016 Mar 16. PubMed PMID: 27021528.
  • 6: Kleinert R, Prenzel K, Stoecklein N, Alakus H, Bollschweiler E, Hölscher A, Warnecke-Eberz U. Gene Expression of Col11A1 Is a Marker Not only for Pancreas Carcinoma But also for Adenocarcinoma of the Papilla of Vater, Discriminating Between Carcinoma and Chronic Pancreatitis. Anticancer Res. 2015 Nov;35(11):6153-8. PubMed PMID: 26504042.
  • 7: Freire J, García-Berbel L, García-Berbel P, Pereda S, Azueta A, García-Arranz P, De Juan A, Vega A, Hens Á, Enguita A, Muñoz-Cacho P, Gómez-Román J. Collagen Type XI Alpha 1 Expression in Intraductal Papillomas Predicts Malignant Recurrence. Biomed Res Int. 2015;2015:812027. doi: 10.1155/2015/812027. Epub 2015 Sep 13. PubMed PMID: 26448946; PubMed Central PMCID: PMC4584034.
  • 8: Wu YH, Chang TH, Huang YF, Chen CC, Chou CY. COL11A1 confers chemoresistance on ovarian cancer cells through the activation of Akt/c/EBPβ pathway and PDK1 stabilization. Oncotarget. 2015 Sep 15;6(27):23748-63. PubMed PMID: 26087191; PubMed Central PMCID: PMC4695149.
  • 9: Vázquez-Villa F, García-Ocaña M, Galván JA, García-Martínez J, García-Pravia C, Menéndez-Rodríguez P, González-del Rey C, Barneo-Serra L, de Los Toyos JR. COL11A1/(pro)collagen 11A1 expression is a remarkable biomarker of human invasive carcinoma-associated stromal cells and carcinoma progression. Tumour Biol. 2015 Apr;36(4):2213-22. doi: 10.1007/s13277-015-3295-4. Epub 2015 Mar 12. Review. PubMed PMID: 25761876.
  • 10: Raglow Z, Thomas SM. Tumor matrix protein collagen XIα1 in cancer. Cancer Lett. 2015 Feb 28;357(2):448-53. doi: 10.1016/j.canlet.2014.12.011. Epub 2014 Dec 12. Review. PubMed PMID: 25511741; PubMed Central PMCID: PMC4307931.
  • 11: Galván JA, García-Martínez J, Vázquez-Villa F, García-Ocaña M, García-Pravia C, Menéndez-Rodríguez P, González-del Rey C, Barneo-Serra L, de los Toyos JR. Validation of COL11A1/procollagen 11A1 expression in TGF-β1-activated immortalised human mesenchymal cells and in stromal cells of human colon adenocarcinoma. BMC Cancer. 2014 Nov 23;14:867. doi: 10.1186/1471-2407-14-867. PubMed PMID: 25417197; PubMed Central PMCID: PMC4246482.
  • 12: Freire J, Domínguez-Hormaetxe S, Pereda S, De Juan A, Vega A, Simón L, Gómez-Román J. Collagen, type XI, alpha 1: an accurate marker for differential diagnosis of breast carcinoma invasiveness in core needle biopsies. Pathol Res Pract. 2014 Dec;210(12):879-84. doi: 10.1016/j.prp.2014.07.012. Epub 2014 Aug 8. PubMed PMID: 25175819.
  • 13: Hufnagel SB, Weaver KN, Hufnagel RB, Bader PI, Schorry EK, Hopkin RJ. A novel dominant COL11A1 mutation resulting in a severe skeletal dysplasia. Am J Med Genet A. 2014 Oct;164A(10):2607-12. doi: 10.1002/ajmg.a.36688. Epub 2014 Aug 4. PubMed PMID: 25091507.
  • 14: García-Pravia C, Galván JA, Gutiérrez-Corral N, Solar-García L, García-Pérez E, García-Ocaña M, Del Amo-Iribarren J, Menéndez-Rodríguez P, García-García J, de Los Toyos JR, Simón-Buela L, Barneo L. Overexpression of COL11A1 by cancer-associated fibroblasts: clinical relevance of a stromal marker in pancreatic cancer. PLoS One. 2013 Oct 23;8(10):e78327. doi: 10.1371/journal.pone.0078327. eCollection 2013. PubMed PMID: 24194920; PubMed Central PMCID: PMC3808536.
  • 15: Wu YH, Chang TH, Huang YF, Huang HD, Chou CY. COL11A1 promotes tumor progression and predicts poor clinical outcome in ovarian cancer. Oncogene. 2014 Jun 26;33(26):3432-40. doi: 10.1038/onc.2013.307. Epub 2013 Aug 12. PubMed PMID: 23934190.
  • 16: Richards AJ, Fincham GS, McNinch A, Hill D, Poulson AV, Castle B, Lees MM, Moore AT, Scott JD, Snead MP. Alternative splicing modifies the effect of mutations in COL11A1 and results in recessive type 2 Stickler syndrome with profound hearing loss. J Med Genet. 2013 Nov;50(11):765-71. doi: 10.1136/jmedgenet-2012-101499. Epub 2013 Aug 6. PubMed PMID: 23922384; PubMed Central PMCID: PMC3812854.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human COL11A Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products