Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery
Nycodenz AG® Nycodenz AG® XtenCHO ™ Race Starter kit XtenCHO ™ Race Starter kit
View all Products

Human COL11A Recombinant Protein

Reference:
size

100ug, 50ug
Brand

ProteoGenix
Product type

Recombinant Proteins
Host Species

Escherichia coli (E. coli)
Applications

Elisa, WB
Tags:
Specification
Documents
Publications
Reviews
Product nameHuman COL11A Recombinant Protein
Uniprot IDP12107
Uniprot linkhttp://www.uniprot.org/uniprot/P12107
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPR GSTAIGMKETAAAKFERQHMDSPDLGTGGGSGDDDDKSPMGYRGSEFSSAPKAAQAQEPQIDEANIVDDFQEYNYGTMES YQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSP PNEEFGPGVPAETDITETSINGHGAY
Molecular weight48,19 kDa
Protein delivered with Tag?Yes
Purity estimated>95%
BufferTrisHCl 50mM. PBS if dialysis
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAF04724.1
Spec:Entrez GeneID1301
Spec:NCBI Gene AliasesCOLL6, CO11A1, STL2
Spec:SwissProtIDP12107
NCBI ReferenceAAF04724.1
Aliases /SynonymsCO11A1, COBA1, COL11A1, COLL6, Collagen alpha-1(XI) chain, collagen XI, alpha-1 polypeptide, collagen, type XI, alpha 1, STL2
ReferencePX-P1081
NoteFor research use only
Datasheet Download
MSDS Download

Publication

  • 1: Chen S, Zhou K, Yang L, Ding G, Li H. Racial Differences in Esophageal_x000D_ Squamous Cell Carcinoma: Incidence and Molecular Features. Biomed Res Int._x000D_ 2017;2017:1204082. doi: 10.1155/2017/1204082. Epub 2017 Mar 14. PubMed PMID:_x000D_ 28393072; PubMed Central PMCID: PMC5368356.
    • _x000D_ _x000D_ _x000D_
  • 2: Li A, Li J, Lin J, Zhuo W, Si J. COL11A1 is overexpressed in gastric cancer_x000D_ tissues and regulates proliferation, migration and invasion of HGC-27 gastric_x000D_ cancer cells in vitro. Oncol Rep. 2017 Jan;37(1):333-340. doi:_x000D_ 10.3892/or.2016.5276. Epub 2016 Nov 25. PubMed PMID: 28004111.
    • _x000D_ _x000D_ _x000D_
  • 3: Wang J, Zhang C, Wu SG, Shang C, Huang L, Zhang T, Zhang W, Zhang Y, Zhang L. _x000D_ Additional Evidence Supports Association of Common Variants in COL11A1 with_x000D_ Increased Risk of Hip Osteoarthritis Susceptibility. Genet Test Mol Biomarkers._x000D_ 2017 Feb;21(2):86-91. doi: 10.1089/gtmb.2016.0308. Epub 2016 Dec 12. PubMed PMID:_x000D_ 27936936.
    • _x000D_ _x000D_ _x000D_
  • 4: Shen L, Yang M, Lin Q, Zhang Z, Zhu B, Miao C. COL11A1 is overexpressed in_x000D_ recurrent non-small cell lung cancer and promotes cell proliferation, migration, _x000D_ invasion and drug resistance. Oncol Rep. 2016 Aug;36(2):877-85. doi:_x000D_ 10.3892/or.2016.4869. Epub 2016 Jun 10. PubMed PMID: 27373316.
    • _x000D_ _x000D_ _x000D_
  • 5: Zhang D, Zhu H, Harpaz N. Overexpression of α1 chain of type XI collagen_x000D_ (COL11A1) aids in the diagnosis of invasive carcinoma in endoscopically removed_x000D_ malignant colorectal polyps. Pathol Res Pract. 2016 Jun;212(6):545-8. doi:_x000D_ 10.1016/j.prp.2016.03.005. Epub 2016 Mar 16. PubMed PMID: 27021528.
    • _x000D_ _x000D_ _x000D_
  • 6: Kleinert R, Prenzel K, Stoecklein N, Alakus H, Bollschweiler E, Hölscher A,_x000D_ Warnecke-Eberz U. Gene Expression of Col11A1 Is a Marker Not only for Pancreas_x000D_ Carcinoma But also for Adenocarcinoma of the Papilla of Vater, Discriminating_x000D_ Between Carcinoma and Chronic Pancreatitis. Anticancer Res. 2015_x000D_ Nov;35(11):6153-8. PubMed PMID: 26504042.
    • _x000D_ _x000D_ _x000D_
  • 7: Freire J, García-Berbel L, García-Berbel P, Pereda S, Azueta A, García-Arranz _x000D_ P, De Juan A, Vega A, Hens Á, Enguita A, Muñoz-Cacho P, Gómez-Román J. Collagen_x000D_ Type XI Alpha 1 Expression in Intraductal Papillomas Predicts Malignant_x000D_ Recurrence. Biomed Res Int. 2015;2015:812027. doi: 10.1155/2015/812027. Epub 2015_x000D_ Sep 13. PubMed PMID: 26448946; PubMed Central PMCID: PMC4584034.
    • _x000D_ _x000D_ _x000D_
  • 8: Wu YH, Chang TH, Huang YF, Chen CC, Chou CY. COL11A1 confers chemoresistance_x000D_ on ovarian cancer cells through the activation of Akt/c/EBPβ pathway and PDK1_x000D_ stabilization. Oncotarget. 2015 Sep 15;6(27):23748-63. PubMed PMID: 26087191;_x000D_ PubMed Central PMCID: PMC4695149.
    • _x000D_ _x000D_ _x000D_
  • 9: Vázquez-Villa F, García-Ocaña M, Galván JA, García-Martínez J, García-Pravia_x000D_ C, Menéndez-Rodríguez P, González-del Rey C, Barneo-Serra L, de Los Toyos JR._x000D_ COL11A1/(pro)collagen 11A1 expression is a remarkable biomarker of human invasive_x000D_ carcinoma-associated stromal cells and carcinoma progression. Tumour Biol. 2015_x000D_ Apr;36(4):2213-22. doi: 10.1007/s13277-015-3295-4. Epub 2015 Mar 12. Review._x000D_ PubMed PMID: 25761876.
    • _x000D_ _x000D_ _x000D_
  • 10: Raglow Z, Thomas SM. Tumor matrix protein collagen XIα1 in cancer. Cancer_x000D_ Lett. 2015 Feb 28;357(2):448-53. doi: 10.1016/j.canlet.2014.12.011. Epub 2014 Dec_x000D_ 12. Review. PubMed PMID: 25511741; PubMed Central PMCID: PMC4307931.
    • _x000D_ _x000D_ _x000D_
  • 11: Galván JA, García-Martínez J, Vázquez-Villa F, García-Ocaña M, García-Pravia _x000D_ C, Menéndez-Rodríguez P, González-del Rey C, Barneo-Serra L, de los Toyos JR._x000D_ Validation of COL11A1/procollagen 11A1 expression in TGF-β1-activated_x000D_ immortalised human mesenchymal cells and in stromal cells of human colon_x000D_ adenocarcinoma. BMC Cancer. 2014 Nov 23;14:867. doi: 10.1186/1471-2407-14-867._x000D_ PubMed PMID: 25417197; PubMed Central PMCID: PMC4246482.
    • _x000D_ _x000D_ _x000D_
  • 12: Freire J, Domínguez-Hormaetxe S, Pereda S, De Juan A, Vega A, Simón L,_x000D_ Gómez-Román J. Collagen, type XI, alpha 1: an accurate marker for differential_x000D_ diagnosis of breast carcinoma invasiveness in core needle biopsies. Pathol Res_x000D_ Pract. 2014 Dec;210(12):879-84. doi: 10.1016/j.prp.2014.07.012. Epub 2014 Aug 8. _x000D_ PubMed PMID: 25175819.
    • _x000D_ _x000D_ _x000D_
  • 13: Hufnagel SB, Weaver KN, Hufnagel RB, Bader PI, Schorry EK, Hopkin RJ. A novel_x000D_ dominant COL11A1 mutation resulting in a severe skeletal dysplasia. Am J Med_x000D_ Genet A. 2014 Oct;164A(10):2607-12. doi: 10.1002/ajmg.a.36688. Epub 2014 Aug 4._x000D_ PubMed PMID: 25091507.
    • _x000D_ _x000D_ _x000D_
  • 14: García-Pravia C, Galván JA, Gutiérrez-Corral N, Solar-García L, García-Pérez _x000D_ E, García-Ocaña M, Del Amo-Iribarren J, Menéndez-Rodríguez P, García-García J, de_x000D_ Los Toyos JR, Simón-Buela L, Barneo L. Overexpression of COL11A1 by_x000D_ cancer-associated fibroblasts: clinical relevance of a stromal marker in_x000D_ pancreatic cancer. PLoS One. 2013 Oct 23;8(10):e78327. doi:_x000D_ 10.1371/journal.pone.0078327. eCollection 2013. PubMed PMID: 24194920; PubMed_x000D_ Central PMCID: PMC3808536.
    • _x000D_ _x000D_ _x000D_
  • 15: Wu YH, Chang TH, Huang YF, Huang HD, Chou CY. COL11A1 promotes tumor_x000D_ progression and predicts poor clinical outcome in ovarian cancer. Oncogene. 2014 _x000D_ Jun 26;33(26):3432-40. doi: 10.1038/onc.2013.307. Epub 2013 Aug 12. PubMed PMID: _x000D_ 23934190.
    • _x000D_ _x000D_ _x000D_
  • 16: Richards AJ, Fincham GS, McNinch A, Hill D, Poulson AV, Castle B, Lees MM,_x000D_ Moore AT, Scott JD, Snead MP. Alternative splicing modifies the effect of_x000D_ mutations in COL11A1 and results in recessive type 2 Stickler syndrome with_x000D_ profound hearing loss. J Med Genet. 2013 Nov;50(11):765-71. doi:_x000D_ 10.1136/jmedgenet-2012-101499. Epub 2013 Aug 6. PubMed PMID: 23922384; PubMed_x000D_ Central PMCID: PMC3812854.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human COL11A Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products