Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human CKMB recombinant protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human CKMB recombinant protein |
|---|---|
| Uniprot ID | CKM: P06732; CKB:P12277 |
| Uniprot link | http://www.uniprot.org/uniprot/P06732 http://www.uniprot.org/uniprot/P12277 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | CKM Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKGSAWSHPQFEK CKB Sequence: MGSHHHHHHSGPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK |
| Molecular weight | CKM: 44.29kDa; CKB: 43.69kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | 50 mM Tris-HCl pH 8, 150 mM NaCl |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| Aliases /Synonyms | Creatine Kinase MB Isoenzyme Type-II, CKMBITII, CKMBI, CKMB, CKM, CKB, Human Creatine kinase M-type recombinant protein, Human Creatine kinase B-type recombinant protein |
| Reference | PX-P4053 |
| Note | For research use only |
Description of Human CKMB recombinant protein
General Information about Human CKMB recombinant protein
Heterodimer comprised of Creatine kinase M type and Creatine kinase B-type
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.