Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Glucagon-like peptide 1 receptor(GLP1R) protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P43220
Molecular weight:
14.31 kDa

Original price was: €97.00.Current price is: €83.00.

50ug 14% OFF + 83 loyalty points
His Arg24–Tyr145
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Glucagon-like peptide 1 receptor(GLP1R) protein

Product name Glucagon-like peptide 1 receptor(GLP1R) protein
Uniprot ID P43220
Uniprot link https://www.uniprot.org/uniprot/P43220
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Molecular weight 14.31 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >95%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL, 5% trehalose
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg24-Tyr145
Protein Accession P43220
Spec:Entrez GeneID 2740
Spec:NCBI Gene Aliases GLP-1; GLP-1R; GLP-1-R
Spec:SwissProtID Q2M229
NCBI Reference P43220
Aliases /Synonyms GLP-1 receptor,GLP-1-R,GLP-1R
Reference PX-P4732
Note For research use only
Molecular Constructor
His Arg24–Tyr145
Product name Glucagon-like peptide 1 receptor(GLP1R) protein
Uniprot ID P43220
Uniprot link https://www.uniprot.org/uniprot/P43220
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Molecular weight 14.31 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >95%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL, 5% trehalose
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg24-Tyr145
Protein Accession P43220
Spec:Entrez GeneID 2740
Spec:NCBI Gene Aliases GLP-1; GLP-1R; GLP-1-R
Spec:SwissProtID Q2M229
NCBI Reference P43220
Aliases /Synonyms GLP-1 receptor,GLP-1-R,GLP-1R
Reference PX-P4732
Note For research use only
Molecular Constructor
His Arg24–Tyr145
Product name PX-P4732-1MG
Uniprot ID P43220
Uniprot link https://www.uniprot.org/uniprot/P43220
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Molecular weight 14.31 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >95%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL, 5% trehalose
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg24-Tyr145
Protein Accession P43220
Spec:Entrez GeneID 2740
Spec:NCBI Gene Aliases GLP-1; GLP-1R; GLP-1-R
Spec:SwissProtID Q2M229
NCBI Reference P43220
Aliases /Synonyms GLP-1 receptor,GLP-1-R,GLP-1R
Reference PX-P4732
Note For research use only
Molecular Constructor
His Arg24–Tyr145

Glucagon-like peptide 1 receptor(GLP1R) protein

There are no reviews yet.

Be the first to review “Glucagon-like peptide 1 receptor(GLP1R) protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products