Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Glucagon-like peptide 1 receptor(GLP1R) protein |
|---|---|
| Uniprot ID | P43220 |
| Uniprot link | https://www.uniprot.org/uniprot/P43220 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
| Molecular weight | 14.31 kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >95%by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL, 5% trehalose |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Arg24-Tyr145 |
| Protein Accession | P43220 |
| Spec:Entrez GeneID | 2740 |
| Spec:NCBI Gene Aliases | GLP-1; GLP-1R; GLP-1-R |
| Spec:SwissProtID | Q2M229 |
| NCBI Reference | P43220 |
| Aliases /Synonyms | GLP-1 receptor,GLP-1-R,GLP-1R |
| Reference | PX-P4732 |
| Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.