Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Glucagon-like peptide 1 receptor(GLP1R) protein |
---|---|
Uniprot ID | P43220 |
Uniprot link | https://www.uniprot.org/uniprot/P43220 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
Molecular weight | 14.31 kDa |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | >95%by SDS-PAGE |
Buffer | PBS pH 7.5, 0.02% SKL, 5% trehalose |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Arg24-Tyr145 |
Protein Accession | P43220 |
Spec:Entrez GeneID | 2740 |
Spec:NCBI Gene Aliases | GLP-1; GLP-1R; GLP-1-R |
Spec:SwissProtID | Q2M229 |
NCBI Reference | P43220 |
Aliases /Synonyms | GLP-1 receptor,GLP-1-R,GLP-1R |
Reference | PX-P4732 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.