Skip to main content
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Cow PAG1B Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameCow PAG1B Recombinant Protein
Uniprot IDQ29432
Uniprot linkhttp://www.uniprot.org/uniprot/Q29432
Origin speciesCow
Expression systemProkaryotic expression
SequenceMGHHHHHHHHHHSSGHIEGRHMLEMKWLVLLGLVAFSECIVKIPLRRLKTMRNVVSGKNMLNNFLKEHAYSLSQISFRGS NLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFRLTNKTFRITYGSGR MKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDKLKNQRAISEPVFAFYLSKDERE GSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCKALVDTGTSDIVGPRRLVNNIHRLIGAIPRG SEHYVPCSEVNTLPSIVFTINGINYPVPGRAYILKDDRGRCYTTFQENRVSSSTETWYLGDVFLRLYFSVFDRGNDRIGL ARAV
Molecular weight45,67 kDa
Purity estimated80%
BufferNaH2PO4 75mM, NaCl 150mM, Urea 6M, pH 6-8.
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionNP_776836.1
Spec:Entrez GeneID281964
Spec:NCBI Gene AliasesPAG1B
Spec:SwissProtIDQ29432
NCBI ReferenceNP_776836.1
Aliases /SynonymsPAG1B, pregnancy-associated glycoprotein 1 precursor, PAG 1, Pregnancy-specific protein B, PSP-B
ReferencePX-P1136
NoteFor research use only

Description of Cow PAG1B Recombinant Protein

General information onCow PAG1B Recombinant Protein

Pregnancy associated glycoproteins (PAGs) are widely glycosylated secretory proteins of ruminant trophoblast cells. Bovine pregnancy-associated glycoprotein-1 (PAG-1) may play an important role during pregnancy and is defined as a potential biochemical marker of pregnancy in ungulates.

Publication

  • 1: Szenci O, Karen A, Bajcsy AC, Gáspárdy A, de Sousa NM, Beckers JF. Effect of restraint stress on plasma concentrations of cortisol, progesterone and pregnancy associated-glycoprotein-1 in pregnant heifers during late embryonic development. Theriogenology. 2011 Nov;76(8):1380-5. doi: 10.1016/j.theriogenology.2011.05.030. Epub 2011 Aug 26. PubMed PMID: 21872319.
  • 2: Xie S, Green J, Beckers JF, Roberts RM. The gene encoding bovine pregnancy-associated glycoprotein-1, an inactive member of the aspartic proteinase family. Gene. 1995 Jul 4;159(2):193-7. PubMed PMID: 7622048.
  • 3: Mur-Novales R, López-Gatius F, Serrano-Pérez B, García-Ispierto I, Darwich L, Cabezón O, de Sousa NM, Beckers JF, Almería S. Experimental Neospora Caninum Infection in Pregnant Dairy Heifers Raises Concentrations of Pregnancy-Associated Glycoproteins 1 and 2 in Foetal Fluids. Reprod Domest Anim. 2016 Apr;51(2):282-6. doi: 10.1111/rda.12678. Epub 2016 Mar 3. PubMed PMID: 26936628.
  • 4: Serrano-Pérez B, Hansen PJ, Mur-Novales R, García-Ispierto I, de Sousa NM, Beckers JF, Almería S, López-Gatius F. Crosstalk between uterine serpin (SERPINA14) and pregnancy-associated glycoproteins at the fetal-maternal interface in pregnant dairy heifers experimentally infected with Neospora caninum. Theriogenology. 2016 Aug;86(3):824-30. doi: 10.1016/j.theriogenology.2016.03.003. Epub 2016 Mar 11. PubMed PMID: 27045629.
  • 5: Serrano-Pérez B, Garcia-Ispierto I, de Sousa NM, Beckers JF, Almería S, López-Gatius F. Gamma interferon production and plasma concentrations of pregnancy-associated glycoproteins 1 and 2 in gestating dairy cows naturally infected with Neospora caninum. Reprod Domest Anim. 2014 Apr;49(2):275-80. doi: 10.1111/rda.12267. Epub 2014 Jan 23. PubMed PMID: 24456132.
  • 6: Xie SC, Low BG, Nagel RJ, Kramer KK, Anthony RV, Zoli AP, Beckers JF, Roberts RM. Identification of the major pregnancy-specific antigens of cattle and sheep as inactive members of the aspartic proteinase family. Proc Natl Acad Sci U S A. 1991 Nov 15;88(22):10247-51. PubMed PMID: 1946444; PubMed Central PMCID: PMC52905.
  • 7: Ishiwata H, Katsuma S, Kizaki K, Patel OV, Nakano H, Takahashi T, Imai K, Hirasawa A, Shiojima S, Ikawa H, Suzuki Y, Tsujimoto G, Izaike Y, Todoroki J, Hashizume K. Characterization of gene expression profiles in early bovine pregnancy using a custom cDNA microarray. Mol Reprod Dev. 2003 May;65(1):9-18. PubMed PMID: 12658628.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Cow PAG1B Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products