Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Cell division protein FtsA(ftsA) |
|---|---|
| Uniprot ID | WP_000588463.1 |
| Uniprot link | http://www.uniprot.org/uniprot/WP_000588463.1 |
| Expression system | Prokaryotic expression |
| Sequence | MGIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSV YLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVH LITCHNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQL RQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK RVTASVGSWIKRLNSWLRKEFGSHHHHHH |
| Molecular weight | 46.27kDa |
| Purity estimated | 90% by SDS-PAGE |
| Buffer | PBS, pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | full length |
| Reference | PX-P4514 |
| Note | For research use only |
FtsA stands for “filamentous temperature sensitive A”. FtsA is a bacterial protein that is related to actin through overall structural similarity and its ATP binding pocket. These proteins, along with other bacterial actin homologs (such as MreB, ParM, and MamK), suggest that eukaryotic actins share a common lineage. Like other bacterial actins, FtsA binds to ATP and can form actin-like filaments. The FtsA-FtsA interface has been determined through structural analysis and genetic analysis. Although FtsA is present in many different gram-positive and gram-negative bacterial species, it is not present in actinomycetes and cyanobacteria. The structure of FtsA is also similar to type IV fimbriae ATPase PilM
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.