Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Cell division protein FtsA(ftsA)

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameCell division protein FtsA(ftsA)
Uniprot IDWP_000588463.1
Uniprot linkhttp://www.uniprot.org/uniprot/WP_000588463.1
Expression systemProkaryotic expression
SequenceMGIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSV YLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVH LITCHNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQL RQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK RVTASVGSWIKRLNSWLRKEFGSHHHHHH
Molecular weight46.27kDa
Purity estimated90% by SDS-PAGE
BufferPBS, pH 7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment Typefull length
ReferencePX-P4514
NoteFor research use only

Description of Cell division protein FtsA(ftsA)

General Information about Cell division protein FtsA

FtsA stands for “filamentous temperature sensitive A”. FtsA is a bacterial protein that is related to actin through overall structural similarity and its ATP binding pocket. These proteins, along with other bacterial actin homologs (such as MreB, ParM, and MamK), suggest that eukaryotic actins share a common lineage. Like other bacterial actins, FtsA binds to ATP and can form actin-like filaments. The FtsA-FtsA interface has been determined through structural analysis and genetic analysis. Although FtsA is present in many different gram-positive and gram-negative bacterial species, it is not present in actinomycetes and cyanobacteria. The structure of FtsA is also similar to type IV fimbriae ATPase PilM

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Cell division protein FtsA(ftsA)”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products