Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD81 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P60033
Molecular weight:
10.59kDa

Original price was: €315.00.Current price is: €284.00.

50ug 10% OFF + 284 loyalty points
His Phe113~Lys201
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD81 Recombinant Protein

Product name PX-P4091-100
Uniprot ID P60033
Uniprot link http://www.uniprot.org/uniprot/P60033
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 10.59kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113~Lys201
Aliases /Synonyms TAPA1, TSPAN28
Reference PX-P4091
Note For research use only
Molecular Constructor
His Phe113~Lys201
Product name PX-P4091-1MG
Uniprot ID P60033
Uniprot link http://www.uniprot.org/uniprot/P60033
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 10.59kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113~Lys201
Aliases /Synonyms TAPA1, TSPAN28
Reference PX-P4091
Note For research use only
Molecular Constructor
His Phe113~Lys201
Product name PX-P4091-50
Uniprot ID P60033
Uniprot link http://www.uniprot.org/uniprot/P60033
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 10.59kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113~Lys201
Aliases /Synonyms TAPA1, TSPAN28
Reference PX-P4091
Note For research use only
Molecular Constructor
His Phe113~Lys201

General Information about CD81 Recombinant Protein

CD81, also known as TAPA-1, belongs to the transmembrane superfamily 4, also known as the tetraspanin family. Members of this family mediate transduction events that play a role in the regulation of cell development, activation, growth and movement. CD81 is a widely expressed cell surface protein that participates in various amazing biological reactions. It involves the adhesion, morphology, activation, proliferation and differentiation of B cells, T cells and other cells. On B cells, CD81 is part of a complex with CD21, CD19 and Leul3. The combination of ag-specific recognition and CD21-mediated complementary recognition of the complex lowers the threshold for activation of the B cell B cell receptor.

CD81 Recombinant Protein

There are no reviews yet.

Be the first to review “CD81 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products