Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | CD81 Recombinant Protein |
---|---|
Uniprot ID | P60033 |
Uniprot link | http://www.uniprot.org/uniprot/P60033 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK |
Molecular weight | 10.59kDa |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Phe113~Lys201 |
Aliases /Synonyms | TAPA1, TSPAN28 |
Reference | PX-P4091 |
Note | For research use only |
CD81, also known as TAPA-1, belongs to the transmembrane superfamily 4, also known as the tetraspanin family. Members of this family mediate transduction events that play a role in the regulation of cell development, activation, growth and movement. CD81 is a widely expressed cell surface protein that participates in various amazing biological reactions. It involves the adhesion, morphology, activation, proliferation and differentiation of B cells, T cells and other cells. On B cells, CD81 is part of a complex with CD21, CD19 and Leul3. The combination of ag-specific recognition and CD21-mediated complementary recognition of the complex lowers the threshold for activation of the B cell B cell receptor.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.