Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | CD81 Recombinant Protein |
|---|---|
| Uniprot ID | P60033 |
| Uniprot link | http://www.uniprot.org/uniprot/P60033 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK |
| Molecular weight | 10.59kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Phe113~Lys201 |
| Aliases /Synonyms | TAPA1, TSPAN28 |
| Reference | PX-P4091 |
| Note | For research use only |
CD81, also known as TAPA-1, belongs to the transmembrane superfamily 4, also known as the tetraspanin family. Members of this family mediate transduction events that play a role in the regulation of cell development, activation, growth and movement. CD81 is a widely expressed cell surface protein that participates in various amazing biological reactions. It involves the adhesion, morphology, activation, proliferation and differentiation of B cells, T cells and other cells. On B cells, CD81 is part of a complex with CD21, CD19 and Leul3. The combination of ag-specific recognition and CD21-mediated complementary recognition of the complex lowers the threshold for activation of the B cell B cell receptor.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.