Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD28 Recombinant Protein |
|---|---|
| Uniprot ID | P10747 |
| Uniprot link | http://www.uniprot.org/uniprot/P10747 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP |
| Molecular weight | 42.63KDa |
| Protein delivered with Tag? | C-terminal Fc Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Pro152 |
| Aliases /Synonyms | / |
| Reference | PX-P4080 |
| Note | For research use only |
CD28 (Cluster of Differentiation 28) belongs to the immunoglobulin (Ig) superfamily. It is a glycoprotein linked to dyslipidemia. It is structurally composed of a single Ig V-like extracellular domain, transmembrane domain and intracellular domain. Mouse CD28 is structurally expressed on the surface of all parietal cells and developing thymocytes in the form of disulfide-bound homodimers or monomers. CD28 can bind B7-1 and B7-2 ligands and together play an important role in the response of T lymphocytes and B lymphocytes and tolerance of peripheral cells. Thus, CD28 is involved in the activation of T cells, the induction of cell proliferation, the production of cytokines and the acceleration of T cell survival.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.