Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
CD270 Recombinant Protein
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD270 Recombinant Protein |
|---|---|
| Uniprot ID | Q92956 |
| Uniprot link | http://www.uniprot.org/uniprot/Q92956 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWV |
| Molecular weight | 36kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Val202 |
| Protein Accession | Q92956 |
| Spec:Entrez GeneID | 8764 |
| Spec:NCBI Gene Aliases | TR2; ATAR; HVEA; HVEM; CD270; LIGHTR |
| Spec:SwissProtID | Q6IB95 |
| NCBI Reference | Q92956 |
| Aliases /Synonyms | HVEA, HVEM,TR2 |
| Reference | PX-P4113 |
| Note | For research use only |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.