Uncharacterized protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameUncharacterized protein
Uniprot IDF9XMT4
Uniprot linkhttps://www.uniprot.org/uniprot/F9XMT4
Expression systemProcaryotic expression
SequenceMGKYLLPTAAAGLLLLAAQPAMAAPQNPPTSCSAAPQPTGTGSPGTVCGSTTFTNYTVKAGDTLGAIAKQYNSGVCDIAK VNGIDNPDYIKPDQVLSIPANCVTPDNTSCVKPVPVITNTCVLGVGSTYTVKSGDSFSAIATSFNITLASLEARNPQIPN YDLIFPGQVINTPLCPNSVCDSIGTYVIESGDIFYNLAQSNNVTVGQLESLNVNVNVTDIHPGDIIILPHNCHNITASAG SHHHHHH
Molecular weight25.62kDa
Protein delivered with Tag?C-terminal His Tag
Purity estimated>50% by SDS-PAGE
BufferPBS, pH7.5
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeAla27-Ala232
Spec:Entrez GeneID13396123
Aliases /Synonyms/
ReferencePX-P4481
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Uncharacterized protein”

Your email address will not be published. Required fields are marked *

Related products

Anti His tag mouse monoclonal antibody
Tag Antibody Anti His tag mouse monoclonal antibody PTX17851-100 180€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.